UniProt ID | RHOC_MOUSE | |
---|---|---|
UniProt AC | Q62159 | |
Protein Name | Rho-related GTP-binding protein RhoC | |
Gene Name | Rhoc | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 193 | |
Subcellular Localization |
Cell membrane Lipid-anchor Cytoplasmic side . Cleavage furrow. Translocates to the equatorial region before furrow formation in a ECT2-dependent manner.. |
|
Protein Description | Regulates a signal transduction pathway linking plasma membrane receptors to the assembly of focal adhesions and actin stress fibers. Serves as a microtubule-dependent signal that is required for the myosin contractile ring formation during cell cycle cytokinesis. Regulates apical junction formation in bronchial epithelial cells.. | |
Protein Sequence | MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYIADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRQDEHTRRELAKMKQEPVRSEEGRDMANRISAFGYLECSAKTKEGVREVFEMATRAGLQVRKNKRRRGCPIL | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
7 | Acetylation | -MAAIRKKLVIVGDG -CCCCCCEEEEECCC | 37.83 | 23806337 | |
7 | Succinylation | -MAAIRKKLVIVGDG -CCCCCCEEEEECCC | 37.83 | 23806337 | |
16 | S-nitrosocysteine | VIVGDGACGKTCLLI EEECCCCCCCEEEEE | 7.60 | - | |
16 | S-nitrosylation | VIVGDGACGKTCLLI EEECCCCCCCEEEEE | 7.60 | 21278135 | |
19 | Phosphorylation | GDGACGKTCLLIVFS CCCCCCCEEEEEEEE | 8.15 | 17203969 | |
26 | Phosphorylation | TCLLIVFSKDQFPEV EEEEEEEECCCCCCE | 25.16 | 17203969 | |
34 | Phosphorylation | KDQFPEVYVPTVFEN CCCCCCEECCCEECC | 10.07 | 29514104 | |
66 | Phosphorylation | DTAGQEDYDRLRPLS ECCCCCCHHHCCCCC | 11.38 | 25159016 | |
104 | Ubiquitination | EKWTPEVKHFCPNVP CCCCHHHHHHCCCCC | 29.33 | - | |
107 | S-nitrosocysteine | TPEVKHFCPNVPIIL CHHHHHHCCCCCEEE | 2.10 | - | |
107 | S-nitrosylation | TPEVKHFCPNVPIIL CHHHHHHCCCCCEEE | 2.10 | 20925432 | |
118 | Ubiquitination | PIILVGNKKDLRQDE CEEEECCHHHHCCCH | 41.56 | - | |
119 | Ubiquitination | IILVGNKKDLRQDEH EEEECCHHHHCCCHH | 67.03 | - | |
135 | Ubiquitination | RRELAKMKQEPVRSE HHHHHHHHHCCCCCH | 51.29 | - | |
159 | S-nitrosylation | SAFGYLECSAKTKEG HHHHHHHCCCCCHHH | 4.41 | 21278135 | |
159 | S-nitrosocysteine | SAFGYLECSAKTKEG HHHHHHHCCCCCHHH | 4.41 | - | |
190 | Geranylgeranylation | KNKRRRGCPIL---- HCCCCCCCCCC---- | 1.47 | - | |
190 | Methylation | KNKRRRGCPIL---- HCCCCCCCCCC---- | 1.47 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RHOC_MOUSE !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RHOC_MOUSE !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RHOC_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of RHOC_MOUSE !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
Phosphorylation | |
Reference | PubMed |
"Protein phosphorylation and expression profiling by Yin-yangmultidimensional liquid chromatography (Yin-yang MDLC) massspectrometry."; Dai J., Jin W.-H., Sheng Q.-H., Shieh C.-H., Wu J.-R., Zeng R.; J. Proteome Res. 6:250-262(2007). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-19 AND SER-26, AND MASSSPECTROMETRY. |