dbPTM

RHES_MOUSE - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	RHES_MOUSE
UniProt AC	P63032
Protein Name	GTP-binding protein Rhes
Gene Name	Rasd2
Organism	Mus musculus (Mouse).
Sequence Length	266
Subcellular Localization	Cell membrane Lipid-anchor.
Protein Description	GTPase signaling protein that binds to and hydrolyzes GTP. Regulates signaling pathways involving G-proteins-coupled receptor and heterotrimeric proteins such as GNB1, GNB2 and GNB3. May be involved in selected striatal competencies, mainly locomotor activity and motor coordination..
Protein Sequence	MMKTLSSGNCTLNVPAKNSYRMVVLGASRVGKSSIVSRFLNGRFEDQYTPTIEDFHRKVYNIHGDMYQLDILDTSGNHPFPAMRRLSILTGDVFILVFSLDSRESFDEVKRLQKQILEVKSCLKNKTKEAAELPMVICGNKNDHSELCRQVPAMEAELLVSGDENCAYFEVSAKKNTNVNEMFYVLFSMAKLPHEMSPALHHKISVQYGDAFHPRPFCMRRTKVAGAYGMVSPFARRPSVNSDLKYIKAKVLREGQARERDKCSIQ

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
4	Phosphorylation	----MMKTLSSGNCT ----CCCCCCCCCEE	17.61	29899451
6	Phosphorylation	--MMKTLSSGNCTLN --CCCCCCCCCEEEE	41.24	23140645
7	Phosphorylation	-MMKTLSSGNCTLNV -CCCCCCCCCEEEEE	36.82	23140645
11	Phosphorylation	TLSSGNCTLNVPAKN CCCCCCEEEEECCCC	25.93	23140645
19	Phosphorylation	LNVPAKNSYRMVVLG EEECCCCCEEEEEEC	17.26	23140645
20	Phosphorylation	NVPAKNSYRMVVLGA EECCCCCEEEEEECC	16.48	30635358
110	Ubiquitination	RESFDEVKRLQKQIL CCCHHHHHHHHHHHH	45.39	27667366
239	Phosphorylation	SPFARRPSVNSDLKY CCCCCCCCCCCCHHH	31.92	29899451
263	Methylation	QARERDKCSIQ---- CCCCHHCCCCC----	5.19	-
263	Farnesylation	QARERDKCSIQ---- CCCCHHCCCCC----	5.19	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of RHES_MOUSE !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of RHES_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of RHES_MOUSE !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of RHES_MOUSE !!

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of RHES_MOUSE

Related Literatures of Post-Translational Modification