UniProt ID | RHBD3_MOUSE | |
---|---|---|
UniProt AC | Q8BP97 | |
Protein Name | Rhomboid domain-containing protein 3 | |
Gene Name | Rhbdd3 | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 385 | |
Subcellular Localization |
Membrane Multi-pass membrane protein . |
|
Protein Description | ||
Protein Sequence | MHAWEAPGSLSRALPLASSVLMLLLSCLWLLGAGPSLRLAPELLMEPWQVHRLLTHALGHTALPGLLLSLLLLPTLGWWQECHLGTVRFLHNSTVLALATGLLAVLLAGLGVSGAAGGCGYMPVHLAMLAGQSHHPGWPQRTLPPWLLPWLLLALTLLLSSEPPFLQLLCGLLTGLAYAAGAFQWLELSEQRLQVLQEGVLCKSLARCWPLRLFPTPGSLGELPVTYPAGVRPATPRPPYLASSDSWPHSDGSAQLPPRLGPGQLTWKNSERGLDWAGSSFASATTMWAALDEQMLQEGIQASLLDVSVQGSQSSLWLPKPSVSSLRLQQLQHMGFPTEQAAVALAATGRVEGAVSLLVEGLVDTEALVTEGRSSPAHCTGTGAS | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
268 | Ubiquitination | GPGQLTWKNSERGLD CCCCCEECCCCCCCC | 45.41 | - | |
322 | Phosphorylation | SLWLPKPSVSSLRLQ CEECCCCCCCHHHHH | 40.53 | 23737553 | |
324 | Phosphorylation | WLPKPSVSSLRLQQL ECCCCCCCHHHHHHH | 28.17 | 23737553 | |
325 | Phosphorylation | LPKPSVSSLRLQQLQ CCCCCCCHHHHHHHH | 18.49 | 23737553 | |
374 | Phosphorylation | ALVTEGRSSPAHCTG HHHCCCCCCCCCCCC | 52.08 | 30352176 | |
375 | Phosphorylation | LVTEGRSSPAHCTGT HHCCCCCCCCCCCCC | 25.42 | 29899451 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RHBD3_MOUSE !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RHBD3_MOUSE !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RHBD3_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
NEMO_MOUSE | Ikbkg | physical | 24859449 | |
TNAP3_MOUSE | Tnfaip3 | physical | 24859449 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...