RHBD3_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: RHBD3_HUMAN
• UniProt AC: Q9Y3P4
• Protein Name: Rhomboid domain-containing protein 3
• Gene Name: RHBDD3
• Organism: Homo sapiens (Human).
• Sequence Length: 386
• Subcellular Localization: Membrane ; Multi-pass membrane protein .
• Protein Sequence: MHARGPHGQLSPALPLASSVLMLLMSTLWLVGAGPGLVLAPELLLDPWQVHRLLTHALGHTALPGLLLSLLLLPTVGWQQECHLGTLRFLHASALLALASGLLAVLLAGLGLSSAAGSCGYMPVHLAMLAGEGHRPRRPRGALPPWLSPWLLLALTPLLSSEPPFLQLLCGLLAGLAYAAGAFRWLEPSERRLQVLQEGVLCRTLAGCWPLRLLATPGSLAELPVTHPAGVRPPIPGPPYVASPDLWSHWEDSALPPPSLRPVQPTWEGSSEAGLDWAGASFSPGTPMWAALDEQMLQEGIQASLLDGPAQEPQSAPWLSKSSVSSLRLQQLERMGFPTEQAVVALAATGRVEGAVSLLVGGQVGTETLVTHGKGGPAHSEGPGPP

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
325	Phosphorylation	WLSKSSVSSLRLQQL CCCHHHHHHHHHHHH	26.13	24719451
326	Phosphorylation	LSKSSVSSLRLQQLE CCHHHHHHHHHHHHH	18.49	24719451
374	Ubiquitination	ETLVTHGKGGPAHSE EEEEECCCCCCCCCC	53.76	21906983

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of RHBD3_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of RHBD3_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of RHBD3_HUMAN !!

Protein-Protein Interaction

Oops, there are no PPI records of RHBD3_HUMAN !!

Drug and Disease Associations

• Kegg Disease
• There are no disease associations of PTM sites.
• OMIM Disease
• There are no disease associations of PTM sites.
• Kegg Drug
• There are no disease associations of PTM sites.
• DrugBank
• There are no disease associations of PTM sites.