| UniProt ID | RHAG_HUMAN | |
|---|---|---|
| UniProt AC | Q02094 | |
| Protein Name | Ammonium transporter Rh type A | |
| Gene Name | RHAG | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 409 | |
| Subcellular Localization |
Membrane Multi-pass membrane protein. |
|
| Protein Description | Associated with rhesus blood group antigen expression. [PubMed: 19744193 May be part of an oligomeric complex which is likely to have a transport or channel function in the erythrocyte membrane] | |
| Protein Sequence | MRFTFPLMAIVLEIAMIVLFGLFVEYETDQTVLEQLNITKPTDMGIFFELYPLFQDVHVMIFVGFGFLMTFLKKYGFSSVGINLLVAALGLQWGTIVQGILQSQGQKFNIGIKNMINADFSAATVLISFGAVLGKTSPTQMLIMTILEIVFFAHNEYLVSEIFKASDIGASMTIHAFGAYFGLAVAGILYRSGLRKGHENEESAYYSDLFAMIGTLFLWMFWPSFNSAIAEPGDKQCRAIVNTYFSLAACVLTAFAFSSLVEHRGKLNMVHIQNATLAGGVAVGTCADMAIHPFGSMIIGSIAGMVSVLGYKFLTPLFTTKLRIHDTCGVHNLHGLPGVVGGLAGIVAVAMGASNTSMAMQAAALGSSIGTAVVGGLMTGLILKLPLWGQPSDQNCYDDSVYWKVPKTR | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 37 | N-linked_Glycosylation | QTVLEQLNITKPTDM HHHHHHCCCCCCCCC | 39.31 | UniProtKB CARBOHYD | |
| 246 | Phosphorylation | AIVNTYFSLAACVLT HHHHHHHHHHHHHHH | 13.49 | - | |
| 253 | Phosphorylation | SLAACVLTAFAFSSL HHHHHHHHHHHHHHH | 10.18 | - | |
| 258 | Phosphorylation | VLTAFAFSSLVEHRG HHHHHHHHHHHHHHC | 21.23 | - | |
| 259 | Phosphorylation | LTAFAFSSLVEHRGK HHHHHHHHHHHHHCC | 29.95 | - | |
| 355 | N-linked_Glycosylation | AVAMGASNTSMAMQA HHHHCCCCHHHHHHH | 35.32 | UniProtKB CARBOHYD | |
| 371 | O-linked_Glycosylation | ALGSSIGTAVVGGLM HHCCHHHHHHHHHHH | 18.01 | 29351928 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RHAG_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RHAG_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RHAG_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| ANK1_HUMAN | ANK1 | physical | 12719424 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...