RGS20_MOUSE - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: RGS20_MOUSE
• UniProt AC: Q9QZB1
• Protein Name: Regulator of G-protein signaling 20
• Gene Name: Rgs20
• Organism: Mus musculus (Mouse).
• Sequence Length: 239
• Subcellular Localization: Membrane; Lipid-anchor. Nucleus. Cytoplasm. Shuttles between the cytoplasm/cell membrane and the nucleus Anchored to the membrane through palmitoylation..
• Protein Description: Inhibits signal transduction by increasing the GTPase activity of G protein alpha subunits thereby driving them into their inactive GDP-bound form. Binds selectively to G(z)-alpha and G(alpha)-i2 subunits, accelerates their GTPase activity and regulates their signaling activities. The G(z)-alpha activity is inhibited by the phosphorylation and palmitoylation of the G-protein. Negatively regulates mu-opioid receptor-mediated activation of the G-proteins..
• Protein Sequence: MRTANGGPRARASPSASPADPGLPEGSERTEMRMRQMCGGSETQGPAPSQQGGRGSNACCFCWCCCCTCSCLTVRNQEDQRPQRASHEIRTDIPACEESPTPTLEEVCAWAQSFDNLMVTPAGRNAFREFLRTEFSEENMLFWMACEELKREANKSTIEEKARIIYEDYISILSPKEVSLDSRVREVINRNMVDPSQHIFDDAQLQIYTLMHRDSYPRFMNSTVYKDLLTSLAEKTVEA

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
13	Phosphorylation	GGPRARASPSASPAD CCCCCCCCCCCCCCC	17.52	25521595
15	Phosphorylation	PRARASPSASPADPG CCCCCCCCCCCCCCC	38.59	20415495
17	Phosphorylation	ARASPSASPADPGLP CCCCCCCCCCCCCCC	25.59	25521595
101	Phosphorylation	PACEESPTPTLEEVC CCCCCCCCCCHHHHH	37.88	29899451
156	Phosphorylation	LKREANKSTIEEKAR HHHHHCCCCHHHHHH	34.13	25521595
157	Phosphorylation	KREANKSTIEEKARI HHHHCCCCHHHHHHH	33.73	25521595
166	Phosphorylation	EEKARIIYEDYISIL HHHHHHHHHHHHHHH	10.61	20415495
174	Phosphorylation	EDYISILSPKEVSLD HHHHHHHCCCCCCCC	32.05	24759943
176	Ubiquitination	YISILSPKEVSLDSR HHHHHCCCCCCCCHH	68.33	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of RGS20_MOUSE !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of RGS20_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of RGS20_MOUSE !!

Protein-Protein Interaction

Oops, there are no PPI records of RGS20_MOUSE !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.