RGS19_MOUSE - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: RGS19_MOUSE
• UniProt AC: Q9CX84
• Protein Name: Regulator of G-protein signaling 19
• Gene Name: Rgs19
• Organism: Mus musculus (Mouse).
• Sequence Length: 216
• Subcellular Localization: Membrane; Lipid-anchor.
• Protein Description: Inhibits signal transduction by increasing the GTPase activity of G protein alpha subunits thereby driving them into their inactive GDP-bound form. Binds to G-alpha subfamily 1 members, with the order G(i)a3 > G(i)a1 > G(o)a >> G(z)a/G(i)a2. Activity on G(z)-alpha is inhibited by phosphorylation and palmitoylation of the G-protein (By similarity)..
• Protein Sequence: MPTPHEAEKQHTGPEEADRPPSMSSHDAAPSGPPSRNPCCLCWCCCCSCSWNQERQRAWQVSRESKLQPLPSCEVCTPPSPKEVQSWAQSFDKLMHSPTGRSVFRAFLRTEYSEENMLFWLACEELKAEANQHVVDEKARLIYEDYVSILSPKEVSLDSRVREGINRKMQEPSPHTFDDAQLQIYTLMHRDSYPRFLTSPTYRSLLLQGAPQSSEA

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
22	Phosphorylation	EEADRPPSMSSHDAA CCCCCCCCCCCCCCC	33.70	21082442
24	Phosphorylation	ADRPPSMSSHDAAPS CCCCCCCCCCCCCCC	28.94	21082442
25	Phosphorylation	DRPPSMSSHDAAPSG CCCCCCCCCCCCCCC	19.42	19060867
31	Phosphorylation	SSHDAAPSGPPSRNP CCCCCCCCCCCCCCC	60.24	24759943
35	Phosphorylation	AAPSGPPSRNPCCLC CCCCCCCCCCCEEEH	48.07	24759943
62	Phosphorylation	RQRAWQVSRESKLQP HHHHHHCCCHHCCCC	18.41	24719451
65	Phosphorylation	AWQVSRESKLQPLPS HHHCCCHHCCCCCCC	37.24	25266776
72	Phosphorylation	SKLQPLPSCEVCTPP HCCCCCCCCCCCCCC	30.50	25159016
77	Phosphorylation	LPSCEVCTPPSPKEV CCCCCCCCCCCHHHH	43.33	25521595
80	Phosphorylation	CEVCTPPSPKEVQSW CCCCCCCCHHHHHHH	50.21	25521595
97	Phosphorylation	SFDKLMHSPTGRSVF HHHHHHCCCCHHHHH	15.36	28066266
99	Phosphorylation	DKLMHSPTGRSVFRA HHHHCCCCHHHHHHH	48.52	28066266
138	Ubiquitination	NQHVVDEKARLIYED HHHCCCHHHHHHHHH	34.05	-
143	Phosphorylation	DEKARLIYEDYVSIL CHHHHHHHHHHHHHC	13.82	25159016
146	Phosphorylation	ARLIYEDYVSILSPK HHHHHHHHHHHCCCC	5.55	25159016
148	Phosphorylation	LIYEDYVSILSPKEV HHHHHHHHHCCCCCC	16.16	29899451
151	Phosphorylation	EDYVSILSPKEVSLD HHHHHHCCCCCCCHH	32.05	24759943
198	Phosphorylation	DSYPRFLTSPTYRSL CCCCCHHCCHHHHHH	29.92	29176673
199	Phosphorylation	SYPRFLTSPTYRSLL CCCCHHCCHHHHHHH	19.86	29176673
201	Phosphorylation	PRFLTSPTYRSLLLQ CCHHCCHHHHHHHHC	31.19	29176673
213	Phosphorylation	LLQGAPQSSEA---- HHCCCCCCCCC----	29.14	30482847
214	Phosphorylation	LQGAPQSSEA----- HCCCCCCCCC-----	32.09	19854140

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
151	S	Phosphorylation	Kinase	MAPK1	P63085	Uniprot
151	S	Phosphorylation	Kinase	MAPK3	Q63844	Uniprot

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of RGS19_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of RGS19_MOUSE !!

Protein-Protein Interaction

Oops, there are no PPI records of RGS19_MOUSE !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.