UniProt ID | RGP5_ARATH | |
---|---|---|
UniProt AC | Q9FFD2 | |
Protein Name | Probable UDP-arabinopyranose mutase 5 {ECO:0000305} | |
Gene Name | RGP5 {ECO:0000303|PubMed:21478444} | |
Organism | Arabidopsis thaliana (Mouse-ear cress). | |
Sequence Length | 348 | |
Subcellular Localization | Cytoplasm, cytosol . Golgi apparatus . Localized predominantly in the cytosol. | |
Protein Description | Probable UDP-L-arabinose mutase involved in the biosynthesis of cell wall non-cellulosic polysaccharides.. | |
Protein Sequence | MSLAEINKNEVDIVIGALNADLTQFLTSWRPFFSGFHLIVVKDPELKEELNIPEGFDVDVYSKTDMEKVVGASNSTMFSGYSCRYFGYLVSKKKYIVSIDDDCVPAKDPKGFLVDAVTQHVINLENPATPLFFNTLYDPYCEGADFVRGYPFSLRSGVPCAASCGLWLNLADLDAPTQALKTEKRNTAYVDAVMTVPAKAMLPISGINIAFNRELVGPALVPALRLAGEGKVRWETLEDVWCGMCLKHISDHLGYGVKTGLPYVWRNERGDAVESLRKKWEGMKLMEKSVPFFDSLKLPETALKVEDCVIELAKAVKEQLGSDDPAFTQAADAMVKWVQLWNSVNSSA | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RGP5_ARATH !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RGP5_ARATH !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RGP5_ARATH !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of RGP5_ARATH !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...