dbPTM

RGA9_SCHPO - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	RGA9_SCHPO
UniProt AC	Q9UUJ3
Protein Name	Probable Rho-GTPase-activating protein 9
Gene Name	rga9
Organism	Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
Sequence Length	670
Subcellular Localization	Cytoplasm .
Protein Description
Protein Sequence	MWDGFSNSFWSRDYITGINRAQRLINEGVEQNEKLLQLLHIRAKSASSCSDLLFKSFSKFNKHHPLNEESNDLPSDAAIHQLYESYLMEASLHKKLGEQLNILVINPFANWSKKYSRRVDEIVSAAIVKINNYNSRFSHVNSKKSNLTDRKPIPTSRKSNKSDSLASALSQLDINPSNVNKFDGLINIVDHPYTAEEFANVLLKLMKASTVKRKSYSHLGDYELVTNCSLLFEAIKTTFGLEKDSYVVKAGNQLIQHGLIRLLGIRRVFENDPEIDAQFTTKSQQLLKSYHLSILEVDPYFQVNDPITATNDDPVLQKYNLAYDNLEQCRHELELYLFMVFKDLEQAELDRLNAVKSVLVECSNYSGNFIPSLNSIFIDNLNSFKNLDSLRDMSTQINKHYTGYFIPVSNNELSTKDEYLFLQKSSLTEDNLIVSLVPKILAYLLDAYSYERDEEVLSCVWTTEVPLKDAFDLKSVLRKTDNVESVLNACVEKYTLSSITCSLRLCLLEFPDSLIRSSFYDYFKAIYTTYTDFEDLDHRLYSIKKCLLHLHSTPLHILEEIIRHLSAYAISIRMKDGQIRHLAKIISPCVLRPPDDLNIIPVEDTHPTLLVIDLINEFENLFADLERPSTPPVEIERALTPITTSPQKLKLPRSSSPCKNPSPTRRFRPF

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
170	Phosphorylation	DSLASALSQLDINPS HHHHHHHHCCCCCHH	28.54	21712547
462	Phosphorylation	EVLSCVWTTEVPLKD HHHHHEEEECCCHHH	7.84	27738172
640	Phosphorylation	VEIERALTPITTSPQ CEEEECCCCCCCCCC	16.20	28889911
643	Phosphorylation	ERALTPITTSPQKLK EECCCCCCCCCCCCC	23.56	25720772
644	Phosphorylation	RALTPITTSPQKLKL ECCCCCCCCCCCCCC	38.85	25720772
645	Phosphorylation	ALTPITTSPQKLKLP CCCCCCCCCCCCCCC	19.38	28889911
654	Phosphorylation	QKLKLPRSSSPCKNP CCCCCCCCCCCCCCC	32.98	21712547
655	Phosphorylation	KLKLPRSSSPCKNPS CCCCCCCCCCCCCCC	39.31	21712547
656	Phosphorylation	LKLPRSSSPCKNPSP CCCCCCCCCCCCCCC	35.25	29996109
662	Phosphorylation	SSPCKNPSPTRRFRP CCCCCCCCCCCCCCC	48.58	29996109
664	Phosphorylation	PCKNPSPTRRFRPF- CCCCCCCCCCCCCC-	38.52	29996109

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of RGA9_SCHPO !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of RGA9_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of RGA9_SCHPO !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of RGA9_SCHPO !!

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of RGA9_SCHPO

Related Literatures of Post-Translational Modification

Phosphorylation
Reference	PubMed
"Phosphoproteome analysis of fission yeast."; Wilson-Grady J.T., Villen J., Gygi S.P.; J. Proteome Res. 7:1088-1097(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-640 AND SER-645, ANDMASS SPECTROMETRY.	18257517 [Abstract]