UniProt ID | RFX2_MOUSE | |
---|---|---|
UniProt AC | P48379 | |
Protein Name | DNA-binding protein RFX2 | |
Gene Name | Rfx2 | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 717 | |
Subcellular Localization | Nucleus . Cytoplasm . Mainly expressed in the nucleus and at lower level in cytoplasm. | |
Protein Description | Transcription factor that acts as a key regulator of spermatogenesis. [PubMed: 26248850] | |
Protein Sequence | MQNSEGGADSPASVALRPAAQPMPASPQRVLVQAAGSTPKGTPMQTLTLPRVQPVPPQVQHVYPAQVQYVEGGDAVYANGAIRAAYAYNPDPQLYAPSSAASYFETPGGTQVTVAASSPPAVPSHGMVGITMDVSGTPIVSGAGAYLIHGGMDGTRHSLAHTARSSPATLEMAIETLQKSEGLAPHKGGLLNSHLQWLLDNYETAEGVSLPRSSLYNHYLRHCQEHKLEPVNAASFGKLIRSVFMGLRTRRLGTRGNSKYHYYGIRLKPDSPLNRLQEDTQYMAMRQQPTHQKPRYRPAQKSDSLGDGSAHSNMHGMPDQAMATQGQHHQQYIDVSHVFPEFPAPDLGSTLLQESVTLHDVKALQLVYRRHCEATLDVVMNLQFQYIEKLWLSFWNCKATSSDSCASLPASDEDPEVTLLPKEKLISLCKCEPILQWMRSCDHILYQTLVETLIPDVLRPVPSSLTQAIRNFAKSLEGWLINAMSGFPQQVIQTKVGVVSAFAQTLRRYTSLNHLAQAARAVLQNTSQINQMLSDLNRVDFANVQEQASWVCQCEESLVQRLEHDFKVTLQQQSSLDQWASWLDNVVTQVLKQHSGSPSFPKAARQFLLKWSFYSSMVIRDLTLRSAASFGSFHLIRLLYDEYMFYLVEHRVAQATGETPIAVMGEFNDLASLSLTLLDKEDIGDGHSSEADVDGRSLGEPLVKRERSDPSHPLQGI | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
4 | Phosphorylation | ----MQNSEGGADSP ----CCCCCCCCCCC | 22.26 | 25293948 | |
10 | Phosphorylation | NSEGGADSPASVALR CCCCCCCCCHHCCCC | 23.10 | 25293948 | |
13 | Phosphorylation | GGADSPASVALRPAA CCCCCCHHCCCCCCC | 16.00 | 25293948 | |
26 | Phosphorylation | AAQPMPASPQRVLVQ CCCCCCCCCCEEEEE | 18.72 | 26643407 | |
38 | Phosphorylation | LVQAAGSTPKGTPMQ EEEECCCCCCCCCCC | 28.27 | 27841257 | |
165 | Phosphorylation | SLAHTARSSPATLEM CHHHHHCCCHHHHHH | 37.90 | 19060867 | |
166 | Phosphorylation | LAHTARSSPATLEMA HHHHHCCCHHHHHHH | 17.01 | 25293948 | |
169 | Phosphorylation | TARSSPATLEMAIET HHCCCHHHHHHHHHH | 27.00 | 25293948 | |
235 | Phosphorylation | LEPVNAASFGKLIRS CCCCCHHHHHHHHHH | 31.92 | 21454597 | |
242 | Phosphorylation | SFGKLIRSVFMGLRT HHHHHHHHHHHHHCC | 16.83 | 23737553 | |
249 | Phosphorylation | SVFMGLRTRRLGTRG HHHHHHCCEECCCCC | 25.78 | - | |
271 | Phosphorylation | GIRLKPDSPLNRLQE EEEECCCCCCHHHHH | 39.55 | 21082442 | |
411 | Phosphorylation | SCASLPASDEDPEVT CCCCCCCCCCCCCCE | 39.32 | 25293948 | |
418 | Phosphorylation | SDEDPEVTLLPKEKL CCCCCCCEECCHHHH | 22.40 | 25293948 | |
554 | S-palmitoylation | QASWVCQCEESLVQR HHHHHHHCHHHHHHH | 5.46 | 28680068 | |
689 | Phosphorylation | DIGDGHSSEADVDGR HCCCCCCCCCCCCCC | 31.00 | 28973931 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RFX2_MOUSE !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RFX2_MOUSE !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RFX2_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
MYNN_MOUSE | Mynn | physical | 20211142 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...