UniProt ID | RFPL1_HUMAN | |
---|---|---|
UniProt AC | O75677 | |
Protein Name | Ret finger protein-like 1 | |
Gene Name | RFPL1 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 317 | |
Subcellular Localization | ||
Protein Description | ||
Protein Sequence | MKRLSLVTTNRLSPHGNFLPLCTFPLAVDMAALFQEASSCPVCSDYLEKPMSLECGCAVCFKCINSLQKEPHGEDLLCCCCSMVSQKNKIRPSWQLERLASHIKELEPKLKKILQMNPRMRKFQVDMTLDADTANNFLLISDDLRSVRSGCITQNRQDLAERFDVSICILGSPRFTCGRHYWEVDVGTSTEWDLGVCRESVHRKGRIHLTTERGFWTVSLRDGSRLSASTVPLTFLFVDRKLQRVGIFLDMGMQNVSFFDAEGGSHVYTFRSVSAEEPLHLFFAPPSPPNGDKSVLSICPVINPGTTDAPVHPGEAK | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
5 | Phosphorylation | ---MKRLSLVTTNRL ---CCCEEEEECCCC | 25.48 | 22673903 | |
172 | Phosphorylation | VSICILGSPRFTCGR EEEEEECCCCCCCCC | 14.95 | 20562096 | |
227 | Phosphorylation | LRDGSRLSASTVPLT ECCCCCEECCCCCEE | 21.04 | 22210691 | |
229 | Phosphorylation | DGSRLSASTVPLTFL CCCCEECCCCCEEEE | 26.93 | 22210691 | |
230 | Phosphorylation | GSRLSASTVPLTFLF CCCEECCCCCEEEEE | 26.34 | 22210691 | |
272 | Phosphorylation | SHVYTFRSVSAEEPL CEEEEEECEECCCCE | 19.07 | 26074081 | |
274 | Phosphorylation | VYTFRSVSAEEPLHL EEEEECEECCCCEEE | 31.07 | 26074081 | |
294 | Phosphorylation | SPPNGDKSVLSICPV CCCCCCCCCCEECCC | 32.79 | 22496350 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RFPL1_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RFPL1_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RFPL1_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of RFPL1_HUMAN !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...