RFPL1_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: RFPL1_HUMAN
• UniProt AC: O75677
• Protein Name: Ret finger protein-like 1
• Gene Name: RFPL1
• Organism: Homo sapiens (Human).
• Sequence Length: 317
• Protein Sequence: MKRLSLVTTNRLSPHGNFLPLCTFPLAVDMAALFQEASSCPVCSDYLEKPMSLECGCAVCFKCINSLQKEPHGEDLLCCCCSMVSQKNKIRPSWQLERLASHIKELEPKLKKILQMNPRMRKFQVDMTLDADTANNFLLISDDLRSVRSGCITQNRQDLAERFDVSICILGSPRFTCGRHYWEVDVGTSTEWDLGVCRESVHRKGRIHLTTERGFWTVSLRDGSRLSASTVPLTFLFVDRKLQRVGIFLDMGMQNVSFFDAEGGSHVYTFRSVSAEEPLHLFFAPPSPPNGDKSVLSICPVINPGTTDAPVHPGEAK

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
5	Phosphorylation	---MKRLSLVTTNRL ---CCCEEEEECCCC	25.48	22673903
172	Phosphorylation	VSICILGSPRFTCGR EEEEEECCCCCCCCC	14.95	20562096
227	Phosphorylation	LRDGSRLSASTVPLT ECCCCCEECCCCCEE	21.04	22210691
229	Phosphorylation	DGSRLSASTVPLTFL CCCCEECCCCCEEEE	26.93	22210691
230	Phosphorylation	GSRLSASTVPLTFLF CCCEECCCCCEEEEE	26.34	22210691
272	Phosphorylation	SHVYTFRSVSAEEPL CEEEEEECEECCCCE	19.07	26074081
274	Phosphorylation	VYTFRSVSAEEPLHL EEEEECEECCCCEEE	31.07	26074081
294	Phosphorylation	SPPNGDKSVLSICPV CCCCCCCCCCEECCC	32.79	22496350

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of RFPL1_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of RFPL1_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of RFPL1_HUMAN !!

Protein-Protein Interaction

Oops, there are no PPI records of RFPL1_HUMAN !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.