UniProt ID | RFC4_MOUSE | |
---|---|---|
UniProt AC | Q99J62 | |
Protein Name | Replication factor C subunit 4 | |
Gene Name | Rfc4 | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 364 | |
Subcellular Localization | Nucleus . | |
Protein Description | The elongation of primed DNA templates by DNA polymerase delta and epsilon requires the action of the accessory proteins proliferating cell nuclear antigen (PCNA) and activator 1. This subunit may be involved in the elongation of the multiprimed DNA template (By similarity).. | |
Protein Sequence | MQAFLKGTSVSAKAQLTKDRGTPATAGSSGETKKVKPVPWVEKYRPKCVDEVAFQDEVVAVLRKSLEGADLPNLLFYGPPGTGKTSTILAAARELFGPELFRLRVLELNASDERGIQVVREKVKNFAQLTVSGSRSDGKPCPPFKIVILDEADSMTSAAQAALRRTMEKESKTTRFCLICNYVSRIIEPLTSRCSKFRFKPLSDKIQQERLLDIAEKENVKIGNEEIAYLVKISEGDLRKAITFLQSATRLTGGKEVSEDVITDIAGVIPAATIDGIFTACHSGSFDKLEAVVKNLIDEGHAATQLVNQLHDAIIENENLSDKHKSIITEKLAEVDKCLADGADEHLQLMSLCATVMQQLTQNC | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
1 | Acetylation | -------MQAFLKGT -------CCCCCCCC | 6.14 | - | |
6 | Acetylation | --MQAFLKGTSVSAK --CCCCCCCCCEEHE | 54.40 | - | |
13 | Acetylation | KGTSVSAKAQLTKDR CCCCEEHEEECCCCC | 29.20 | 6585159 | |
22 | Phosphorylation | QLTKDRGTPATAGSS ECCCCCCCCCCCCCC | 15.62 | 29550500 | |
28 | Phosphorylation | GTPATAGSSGETKKV CCCCCCCCCCCCCCC | 32.48 | 29550500 | |
29 | O-linked_Glycosylation | TPATAGSSGETKKVK CCCCCCCCCCCCCCC | 39.47 | 30059200 | |
29 | Phosphorylation | TPATAGSSGETKKVK CCCCCCCCCCCCCCC | 39.47 | 26824392 | |
32 | Phosphorylation | TAGSSGETKKVKPVP CCCCCCCCCCCCCCC | 39.42 | 29550500 | |
135 | Methylation | QLTVSGSRSDGKPCP EEEECCCCCCCCCCC | 42.14 | 16187681 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RFC4_MOUSE !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RFC4_MOUSE !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RFC4_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of RFC4_MOUSE !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...