dbPTM

RFA2_SCHPO - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	RFA2_SCHPO
UniProt AC	Q92373
Protein Name	Replication factor A protein 2
Gene Name	ssb2
Organism	Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
Sequence Length	279
Subcellular Localization	Nucleus.
Protein Description	Binds to single-stranded sequences..
Protein Sequence	MAYDAFGKPGYGPDFNSAFSPGMGGGAGFNEYDQSSQPSVDRQQGAGNKLRPVTIKQILNASQVHADAEFKIDGVEVGQVTFVGVLRNIHAQTTNTTYQIEDGTGMIEVRHWEHIDALSELATDTYVRVYGNIKIFSGKIYIASQYIRTIKDHNEVHFHFLEAIAVHLHFTQKANAVNGANAPGYGTSNALGYNNISSNGAANSLEQKLAEYSLTPAQMTVMQAIHSAPETNEGVHVRQLAQSVGPGIDLTAVTDFLQQEGIIYTTIDENHFKSVLQDQ

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
17	Phosphorylation	GYGPDFNSAFSPGMG CCCCCCCCCCCCCCC	30.59	21712547
20	Phosphorylation	PDFNSAFSPGMGGGA CCCCCCCCCCCCCCC	21.91	21712547
32	Phosphorylation	GGAGFNEYDQSSQPS CCCCCCCCCCCCCCC	22.01	21712547
35	Phosphorylation	GFNEYDQSSQPSVDR CCCCCCCCCCCCCCC	28.22	21712547
36	Phosphorylation	FNEYDQSSQPSVDRQ CCCCCCCCCCCCCCC	40.24	27738172
39	Phosphorylation	YDQSSQPSVDRQQGA CCCCCCCCCCCCCCC	29.07	21712547
215	Phosphorylation	KLAEYSLTPAQMTVM HHHHCCCCHHHHHHH	15.61	29996109

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of RFA2_SCHPO !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of RFA2_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of RFA2_SCHPO !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
RAD22_SCHPO	rad52	physical	23779158

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of RFA2_SCHPO

Related Literatures of Post-Translational Modification