RETNB_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: RETNB_HUMAN
• UniProt AC: Q9BQ08
• Protein Name: Resistin-like beta
• Gene Name: RETNLB
• Organism: Homo sapiens (Human).
• Sequence Length: 111
• Subcellular Localization: Secreted.
• Protein Description: Probable hormone..
• Protein Sequence: MGPSSCLLLILIPLLQLINPGSTQCSLDSVMDKKIKDVLNSLEYSPSPISKKLSCASVKSQGRPSSCPAGMAVTGCACGYGCGSWDVQLETTCHCQCSVVDWTTARCCHLT

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
41	Phosphorylation	KIKDVLNSLEYSPSP HHHHHHHHCCCCCCC	20.58	30206219
44	Phosphorylation	DVLNSLEYSPSPISK HHHHHCCCCCCCCCC	31.04	30206219
45	Phosphorylation	VLNSLEYSPSPISKK HHHHCCCCCCCCCCC	14.99	30206219
47	Phosphorylation	NSLEYSPSPISKKLS HHCCCCCCCCCCCEE	29.00	30206219
50	Phosphorylation	EYSPSPISKKLSCAS CCCCCCCCCCEECHH	27.41	30206219

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of RETNB_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of RETNB_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of RETNB_HUMAN !!

Protein-Protein Interaction

Oops, there are no PPI records of RETNB_HUMAN !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.