dbPTM

RET7_HUMAN - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	RET7_HUMAN
UniProt AC	Q96R05
Protein Name	Retinoid-binding protein 7
Gene Name	RBP7
Organism	Homo sapiens (Human).
Sequence Length	134
Subcellular Localization	Cytoplasm.
Protein Description	Intracellular transport of retinol..
Protein Sequence	MPADLSGTWTLLSSDNFEGYMLALGIDFATRKIAKLLKPQKVIEQNGDSFTIHTNSSLRNYFVKFKVGEEFDEDNRGLDNRKCKSLVIWDNDRLTCIQKGEKKNRGWTHWIEGDKLHLEMFCEGQVCKQTFQRA

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
6	Phosphorylation	--MPADLSGTWTLLS --CCCCCCCCEEEEE	34.42	27251275
8	Phosphorylation	MPADLSGTWTLLSSD CCCCCCCCEEEEECC	16.35	27251275
10	Phosphorylation	ADLSGTWTLLSSDNF CCCCCCEEEEECCCC	20.05	27251275
13	Phosphorylation	SGTWTLLSSDNFEGY CCCEEEEECCCCCCE	38.46	27251275
14	Phosphorylation	GTWTLLSSDNFEGYM CCEEEEECCCCCCEE	36.22	27251275
20	Phosphorylation	SSDNFEGYMLALGID ECCCCCCEEHHHCCH	5.03	27251275
49	Phosphorylation	VIEQNGDSFTIHTNS EEEECCCCEEEECCH	26.20	29978859
51	Phosphorylation	EQNGDSFTIHTNSSL EECCCCEEEECCHHH	18.79	29978859
54	Phosphorylation	GDSFTIHTNSSLRNY CCCEEEECCHHHHEE	32.71	29978859
56	Phosphorylation	SFTIHTNSSLRNYFV CEEEECCHHHHEEEE	31.72	29978859
57	Phosphorylation	FTIHTNSSLRNYFVK EEEECCHHHHEEEEE	33.16	29978859
61	Phosphorylation	TNSSLRNYFVKFKVG CCHHHHEEEEEEECC	11.87	29978859
66	Ubiquitination	RNYFVKFKVGEEFDE HEEEEEEECCCCCCC	43.54	30230243

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of RET7_HUMAN !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of RET7_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of RET7_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
P55G_HUMAN	PIK3R3	physical	25814554

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of RET7_HUMAN

Related Literatures of Post-Translational Modification