UniProt ID | RET5_HUMAN | |
---|---|---|
UniProt AC | P82980 | |
Protein Name | Retinol-binding protein 5 | |
Gene Name | RBP5 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 135 | |
Subcellular Localization | Cytoplasm. | |
Protein Description | Intracellular transport of retinol.. | |
Protein Sequence | MPPNLTGYYRFVSQKNMEDYLQALNISLAVRKIALLLKPDKEIEHQGNHMTVRTLSTFRNYTVQFDVGVEFEEDLRSVDGRKCQTIVTWEEEHLVCVQKGEVPNRGWRHWLEGEMLYLELTARDAVCEQVFRKVR | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
51 | Phosphorylation | EHQGNHMTVRTLSTF EECCCCEEEEEEEEC | 10.17 | 29457462 | |
56 | Phosphorylation | HMTVRTLSTFRNYTV CEEEEEEEECCCEEE | 25.53 | 24719451 | |
85 | Phosphorylation | VDGRKCQTIVTWEEE CCCCCCCEEEEEECC | 27.21 | 30631047 | |
88 | Phosphorylation | RKCQTIVTWEEEHLV CCCCEEEEEECCCEE | 24.25 | 30631047 | |
121 | Phosphorylation | EMLYLELTARDAVCE CEEEEEEHHHHHHHH | 15.40 | 26657352 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RET5_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RET5_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RET5_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of RET5_HUMAN !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...