RET5_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: RET5_HUMAN
• UniProt AC: P82980
• Protein Name: Retinol-binding protein 5
• Gene Name: RBP5
• Organism: Homo sapiens (Human).
• Sequence Length: 135
• Subcellular Localization: Cytoplasm.
• Protein Description: Intracellular transport of retinol..
• Protein Sequence: MPPNLTGYYRFVSQKNMEDYLQALNISLAVRKIALLLKPDKEIEHQGNHMTVRTLSTFRNYTVQFDVGVEFEEDLRSVDGRKCQTIVTWEEEHLVCVQKGEVPNRGWRHWLEGEMLYLELTARDAVCEQVFRKVR

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
51	Phosphorylation	EHQGNHMTVRTLSTF EECCCCEEEEEEEEC	10.17	29457462
56	Phosphorylation	HMTVRTLSTFRNYTV CEEEEEEEECCCEEE	25.53	24719451
85	Phosphorylation	VDGRKCQTIVTWEEE CCCCCCCEEEEEECC	27.21	30631047
88	Phosphorylation	RKCQTIVTWEEEHLV CCCCEEEEEECCCEE	24.25	30631047
121	Phosphorylation	EMLYLELTARDAVCE CEEEEEEHHHHHHHH	15.40	26657352

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of RET5_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of RET5_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of RET5_HUMAN !!

Protein-Protein Interaction

Oops, there are no PPI records of RET5_HUMAN !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.