RET2_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: RET2_HUMAN
• UniProt AC: P50120
• Protein Name: Retinol-binding protein 2
• Gene Name: RBP2
• Organism: Homo sapiens (Human).
• Sequence Length: 134
• Subcellular Localization: Cytoplasm.
• Protein Description: Intracellular transport of retinol..
• Protein Sequence: MTRDQNGTWEMESNENFEGYMKALDIDFATRKIAVRLTQTKVIDQDGDNFKTKTTSTFRNYDVDFTVGVEFDEYTKSLDNRHVKALVTWEGDVLVCVQKGEKENRGWKQWIEGDKLYLELTCGDQVCRQVFKKK

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
74	Phosphorylation	VGVEFDEYTKSLDNR EEEEEHHCCCCCCCC	22.70	-
117	Phosphorylation	WIEGDKLYLELTCGD EEECCEEEEEEECCH	12.13	21394647

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of RET2_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of RET2_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of RET2_HUMAN !!

Protein-Protein Interaction

Oops, there are no PPI records of RET2_HUMAN !!

Drug and Disease Associations

• Kegg Disease
• There are no disease associations of PTM sites.
• OMIM Disease
• There are no disease associations of PTM sites.
• Kegg Drug
• There are no disease associations of PTM sites.
• DrugBank
• DB00162: Vitamin A