UniProt ID | RER1_MOUSE | |
---|---|---|
UniProt AC | Q9CQU3 | |
Protein Name | Protein RER1 | |
Gene Name | Rer1 | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 196 | |
Subcellular Localization |
Golgi apparatus membrane Multi-pass membrane protein. |
|
Protein Description | Involved in the retrieval of endoplasmic reticulum membrane proteins from the early Golgi compartment.. | |
Protein Sequence | MSEGDSVGDSVHGKPSVVYRFFSRLGQIYQSWLDKSTPYTAVRWVVTLGLSFVYMIRVYLLQGWYIVTYALGIYHLNLFIAFLSPKVDPSLMEDSDDGPSLPTKQNEEFRPFIRRLPEFKFWHAATKGILVAMICTFFEAFNVPVFWPILVMYFIMLFCITMKRQIKHMIKYRYIPFTHGKRRYKGKEDVGKTFAS | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Acetylation | ------MSEGDSVGD ------CCCCCCCCC | 50.73 | - | |
2 | Phosphorylation | ------MSEGDSVGD ------CCCCCCCCC | 50.73 | 23684622 | |
6 | Phosphorylation | --MSEGDSVGDSVHG --CCCCCCCCCCCCC | 38.57 | 23684622 | |
10 | Phosphorylation | EGDSVGDSVHGKPSV CCCCCCCCCCCCHHH | 15.30 | 22807455 | |
14 | Acetylation | VGDSVHGKPSVVYRF CCCCCCCCHHHHHHH | 21.17 | 23954790 | |
14 | Ubiquitination | VGDSVHGKPSVVYRF CCCCCCCCHHHHHHH | 21.17 | - | |
90 | Phosphorylation | LSPKVDPSLMEDSDD HCCCCCHHHCCCCCC | 35.57 | 28833060 | |
92 | Oxidation | PKVDPSLMEDSDDGP CCCCHHHCCCCCCCC | 6.71 | 17242355 | |
95 | Phosphorylation | DPSLMEDSDDGPSLP CHHHCCCCCCCCCCC | 25.05 | 27087446 | |
100 | Phosphorylation | EDSDDGPSLPTKQNE CCCCCCCCCCCCCCH | 53.13 | 28833060 | |
104 | Ubiquitination | DGPSLPTKQNEEFRP CCCCCCCCCCHHCHH | 49.54 | - | |
171 | Ubiquitination | RQIKHMIKYRYIPFT HHHHHHHHHCCCCCC | 18.99 | - | |
181 | Ubiquitination | YIPFTHGKRRYKGKE CCCCCCCCCCCCCCC | 26.54 | 27667366 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RER1_MOUSE !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RER1_MOUSE !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RER1_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
SYVN1_HUMAN | SYVN1 | physical | 23129766 | |
CALX_MOUSE | Canx | physical | 23129766 | |
NICA_MOUSE | Ncstn | physical | 23129766 | |
STX6_MOUSE | Stx6 | physical | 23129766 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
Phosphorylation | |
Reference | PubMed |
"Large-scale phosphorylation analysis of mouse liver."; Villen J., Beausoleil S.A., Gerber S.A., Gygi S.P.; Proc. Natl. Acad. Sci. U.S.A. 104:1488-1493(2007). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-95, AND MASSSPECTROMETRY. | |
"Protein phosphorylation and expression profiling by Yin-yangmultidimensional liquid chromatography (Yin-yang MDLC) massspectrometry."; Dai J., Jin W.-H., Sheng Q.-H., Shieh C.-H., Wu J.-R., Zeng R.; J. Proteome Res. 6:250-262(2007). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-95, AND MASSSPECTROMETRY. |