RER1C_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: RER1C_ARATH
• UniProt AC: Q9ZWI7
• Protein Name: Protein RER1C
• Gene Name: RER1C
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 212
• Subcellular Localization: Membrane ; Multi-pass membrane protein .
• Protein Description: Involved in the retrieval of endoplasmic reticulum membrane proteins from the early Golgi compartment..
• Protein Sequence: MESAATAVVPPAAAATTATATDDNLQSSDSSSPADAVNRLIHAFSQRQQHLLDKTVPHVLYRWIACLCVVLIYIVRVYFVEGFYIITYAIGIYLLNLIIAFLSPQEDPEASLTSGGSLPTRRSDEYRPFVRRLPEFKFWLSIIRAFIIGFMMTFFEVFDVPVFWPILLFYWVMLFFLTMRKQIQHMIKYRYVPFSFGKKQYGKKPAPTESSE

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
1	Acetylation	-------MESAATAV -------CCCCCCCC	9.18	-
210	Phosphorylation	KKPAPTESSE----- CCCCCCCCCC-----	42.09	25561503
211	Phosphorylation	KPAPTESSE------ CCCCCCCCC------	40.88	25561503

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of RER1C_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of RER1C_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of RER1C_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.