UniProt ID | RER1B_ARATH | |
---|---|---|
UniProt AC | O48671 | |
Protein Name | Protein RER1B | |
Gene Name | RER1B | |
Organism | Arabidopsis thaliana (Mouse-ear cress). | |
Sequence Length | 195 | |
Subcellular Localization |
Membrane Multi-pass membrane protein . |
|
Protein Description | Involved in the retrieval of endoplasmic reticulum membrane proteins from the early Golgi compartment.. | |
Protein Sequence | MEGSGGDSGSMATPVQKKVHEAWRVYQYYLDKTTPHSTNRWIGTLVFFLIYCLRVYSIHGFYIISYGLGIYLLNLLIGFLSPLVDPELEVSDGATLPTRGSDEFKPFIRRLPEFKFWYSMTKAFCIAFLMTFFSVFDVPVFWPILLCYWVVLFVLTMRRQIAHMIKHKYIPFSIGKQKYSGRKSSANSGGGSRAD | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
1 | Acetylation | -------MEGSGGDS -------CCCCCCCC | 13.69 | 22223895 | |
4 | Phosphorylation | ----MEGSGGDSGSM ----CCCCCCCCCCC | 26.71 | 23328941 | |
101 | Phosphorylation | ATLPTRGSDEFKPFI CCCCCCCCCCCHHHH | 30.58 | 25561503 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RER1B_ARATH !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RER1B_ARATH !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RER1B_ARATH !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of RER1B_ARATH !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...