RER1B_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: RER1B_ARATH
• UniProt AC: O48671
• Protein Name: Protein RER1B
• Gene Name: RER1B
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 195
• Subcellular Localization: Membrane ; Multi-pass membrane protein .
• Protein Description: Involved in the retrieval of endoplasmic reticulum membrane proteins from the early Golgi compartment..
• Protein Sequence: MEGSGGDSGSMATPVQKKVHEAWRVYQYYLDKTTPHSTNRWIGTLVFFLIYCLRVYSIHGFYIISYGLGIYLLNLLIGFLSPLVDPELEVSDGATLPTRGSDEFKPFIRRLPEFKFWYSMTKAFCIAFLMTFFSVFDVPVFWPILLCYWVVLFVLTMRRQIAHMIKHKYIPFSIGKQKYSGRKSSANSGGGSRAD

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
1	Acetylation	-------MEGSGGDS -------CCCCCCCC	13.69	22223895
4	Phosphorylation	----MEGSGGDSGSM ----CCCCCCCCCCC	26.71	23328941
101	Phosphorylation	ATLPTRGSDEFKPFI CCCCCCCCCCCHHHH	30.58	25561503

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of RER1B_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of RER1B_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of RER1B_ARATH !!

Protein-Protein Interaction

Oops, there are no PPI records of RER1B_ARATH !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.