dbPTM

RDM1_MOUSE - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	RDM1_MOUSE
UniProt AC	Q9CQK3
Protein Name	RAD52 motif-containing protein 1
Gene Name	Rdm1
Organism	Mus musculus (Mouse).
Sequence Length	281
Subcellular Localization	Nucleus. Cytoplasm. Nucleus, nucleolus. Nucleus, Cajal body. Nucleus, PML body. After treatment with proteasomal inhibitors and mild heat-shock stress is relocalized to the nucleolus as dot-like or irregular subnuclear structures. Colocalized with nu
Protein Description	May confer resistance to the antitumor agent cisplatin. Binds to DNA and RNA (By similarity)..
Protein Sequence	MAELISFVVPTQSDKVLLVWDLSTGPPAEALSHSLFTVFSQFGLLYSVRVFPNAAVARPGFYAIIKFYSSRDAQRAQKACDGKPLFQTSPVKVRLGTRHKALQHQAFALNSSRCQELANYYFGFSGWSKRIIKLQELSGLEDAALAVPMQKGSPQFLCAVEVVLPPYGCRSPGVGISEEPLRQLEEGQSSFLMKRKTAQKLAFQAAVSDAFQKLTIVVLESGRIAVEYRPTAEDLDARSEEELQNLIQVSCSSWSQSSQREEECLSDFSLEEEDLKLCDPH

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
Oops, there are no PTM records of RDM1_MOUSE !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of RDM1_MOUSE !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of RDM1_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of RDM1_MOUSE !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of RDM1_MOUSE !!

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of RDM1_MOUSE

Related Literatures of Post-Translational Modification