RDM1_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: RDM1_HUMAN
• UniProt AC: Q8NG50
• Protein Name: RAD52 motif-containing protein 1
• Gene Name: RDM1
• Organism: Homo sapiens (Human).
• Sequence Length: 284
• Subcellular Localization: Nucleus . Cytoplasm . Nucleus, nucleolus . Isoform 3 and isoform 10 are predominantly nuclear and nucleolar. After treatment with proteasomal inhibitors and mild heat-shock stress, isoform 1, isoform 3, isoform 5, isoform 7, isoform 8 and isoform 10
• Protein Description: May confer resistance to the antitumor agent cisplatin. Binds to DNA and RNA..
• Protein Sequence: MAELVPFAVPIESDKTLLVWELSSGPTAEALHHSLFTAFSQFGLLYSVRVFPNAAVAHPGFYAVIKFYSARAAHRAQKACDRKQLFQKSPVKVRLGTRHKAVQHQALALNSSKCQELANYYFGFNGCSKRIIKLQELSDLEERENEDSMVPLPKQSLKFFCALEVVLPSCDCRSPGIGLVEEPMDKVEEGPLSFLMKRKTAQKLAIQKALSDAFQKLLIVVLESGKIAVEYRPSEDIVGVRCEEELHGLIQVPCSPWKQYGQEEEGYLSDFSLEEEEFRLPELD

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
16 (in isoform 7)	Phosphorylation	-	30.25	22210691
23 (in isoform 7)	Phosphorylation	-	23.02	22210691
24 (in isoform 7)	Phosphorylation	-	62.51	22210691
65	Ubiquitination	HPGFYAVIKFYSARA CCCHHHHHHHHHHHH	1.62	29967540
76 (in isoform 7)	Phosphorylation	-	12.83	-
77	Ubiquitination	ARAAHRAQKACDRKQ HHHHHHHHHHCCHHH	33.56	29967540
78 (in isoform 7)	Phosphorylation	-	50.42	-
88	Ubiquitination	DRKQLFQKSPVKVRL CHHHHHHHCCCEEEC	49.76	29967540
100	Ubiquitination	VRLGTRHKAVQHQAL EECCCCHHHHHHHHH	47.14	29967540
106	Ubiquitination	HKAVQHQALALNSSK HHHHHHHHHHCCCHH	7.83	22817900
110 (in isoform 2)	Ubiquitination	-	38.33	21906983
110	Ubiquitination	QHQALALNSSKCQEL HHHHHHCCCHHHHHH	38.33	22817900
110 (in isoform 6)	Ubiquitination	-	38.33	21906983
113 (in isoform 4)	Phosphorylation	-	39.49	-
113	Ubiquitination	ALALNSSKCQELANY HHHCCCHHHHHHHHH	39.49	-
115 (in isoform 4)	Phosphorylation	-	53.10	-
129	Ubiquitination	FGFNGCSKRIIKLQE HCCCCHHHHHHHHHH	52.25	22817900
133 (in isoform 5)	Ubiquitination	-	41.57	21906983
133	Ubiquitination	GCSKRIIKLQELSDL CHHHHHHHHHHHHHH	41.57	22817900
133 (in isoform 8)	Ubiquitination	-	41.57	21906983
133 (in isoform 1)	Ubiquitination	-	41.57	21906983
136 (in isoform 3)	Phosphorylation	-	61.76	-
138 (in isoform 3)	Phosphorylation	-	39.12	-
224	Phosphorylation	LLIVVLESGKIAVEY HHHHHHCCCCEEEEE	41.02	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of RDM1_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of RDM1_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of RDM1_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
RUVB2_HUMAN	RUVBL2	physical	26186194
PI4KB_HUMAN	PI4KB	physical	26186194
PI4KB_HUMAN	PI4KB	physical	28514442
RUVB2_HUMAN	RUVBL2	physical	28514442

Drug and Disease Associations

• Kegg Disease
• There are no disease associations of PTM sites.
• OMIM Disease
• There are no disease associations of PTM sites.
• Kegg Drug
• There are no disease associations of PTM sites.
• DrugBank
• There are no disease associations of PTM sites.