RD21A_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: RD21A_ARATH
• UniProt AC: P43297
• Protein Name: Cysteine proteinase RD21A {ECO:0000305}
• Gene Name: RD21A {ECO:0000303|PubMed:8325504}
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 462
• Subcellular Localization: Vacuole . Golgi apparatus . Specifically accumulates in body structures that directly bud from the endoplasmic reticulum and fuse with the vacuole (PubMed:11577182). Passes through the Golgi on its route to the vacuole (PubMed:22396764).
• Protein Description: Cysteine protease that plays a role in immunity, senescence, and biotic and abiotic stresses (Probable). Involved in immunity against the necrotrophic fungal pathogen Botrytis cinerea. [PubMed: 22238602 Involved in elicitor-stimulated programmed cell death (PCD During infection by the necrotrophic fungal pathogen Botrytis cinerea, functions as PCD-promoting protease that is released from the ER body or vacuole to the cytoplasm]
• Protein Sequence: MGFLKPTMAILFLAMVAVSSAVDMSIISYDEKHGVSTTGGRSEAEVMSIYEAWLVKHGKAQSQNSLVEKDRRFEIFKDNLRFVDEHNEKNLSYRLGLTRFADLTNDEYRSKYLGAKMEKKGERRTSLRYEARVGDELPESIDWRKKGAVAEVKDQGGCGSCWAFSTIGAVEGINQIVTGDLITLSEQELVDCDTSYNEGCNGGLMDYAFEFIIKNGGIDTDKDYPYKGVDGTCDQIRKNAKVVTIDSYEDVPTYSEESLKKAVAHQPISIAIEAGGRAFQLYDSGIFDGSCGTQLDHGVVAVGYGTENGKDYWIVRNSWGKSWGESGYLRMARNIASSSGKCGIAIEPSYPIKNGENPPNPGPSPPSPIKPPTQCDSYYTCPESNTCCCLFEYGKYCFAWGCCPLEAATCCDDNYSCCPHEYPVCDLDQGTCLLSKNSPFSVKALKRKPATPFWSQGRKNIA

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
90	N-linked_Glycosylation	VDEHNEKNLSYRLGL CCCCCCCCHHHHCCC	28.21	-
233	S-nitrosylation	YKGVDGTCDQIRKNA CCCCCCCHHHHHHCC	4.42	22115780
342	S-nitrosylation	IASSSGKCGIAIEPS HHHCCCCCEEEECCC	5.63	22115780
414	N-linked_Glycosylation	AATCCDDNYSCCPHE HHHHCCCCCCCCCCC	19.84	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of RD21A_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of RD21A_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of RD21A_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
PRNL2_ARATH	AT2G43120	physical	24947605

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.