| UniProt ID | RCOR3_MOUSE | |
|---|---|---|
| UniProt AC | Q6PGA0 | |
| Protein Name | REST corepressor 3 | |
| Gene Name | Rcor3 | |
| Organism | Mus musculus (Mouse). | |
| Sequence Length | 451 | |
| Subcellular Localization | Nucleus . | |
| Protein Description | May act as a component of a corepressor complex that represses transcription.. | |
| Protein Sequence | MPGMMEKGPELLGKSRSANGGAKSPAGGGGSSANGGLHFSEPESGCSSDDEHGDVGMRVGAEYQARIPEFDPGATKYTDKDNGGMLVWSPYHSIPDAKLDEYIAIAKEKHGYNVEQALGMLFWHKHNIEKSLADLPNFTPFPDEWTVEDKVLFEQAFSFHGKSFHRIQQMLPDKTIASLVKYYYSWKKTRSRTSLMDRQARKLANRHNQGDSDDDVEEAHPMDGNDSDYDPKKEAKREGNADQPVQTSKIGLGRREYQSLQHRHHSQRSKCRPPKGMYLTQEDVVAVSCSPNAANTILRQLDMELISLKRQVQNAKQVNSALKQKMEGGIEEFKPPEAQTPQAPRTLGPSPPAPSSTPTPTVPIATLNQPPPLLRPTLPAAPALHRQPPPLQQQARFIQPRPTLNQPPPPLIRPANSMPPRLNPRPVLTTVGGQQPPSLIGIQTDSQPSLH | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 24 | Phosphorylation | SANGGAKSPAGGGGS CCCCCCCCCCCCCCC | 21.32 | - | |
| 40 | Phosphorylation | ANGGLHFSEPESGCS CCCCCCCCCCCCCCC | 41.30 | 21082442 | |
| 47 | Phosphorylation | SEPESGCSSDDEHGD CCCCCCCCCCCCCCC | 40.08 | 21082442 | |
| 107 | Ubiquitination | DEYIAIAKEKHGYNV HHHHHHHHHHCCCCH | 62.27 | - | |
| 175 | Phosphorylation | QQMLPDKTIASLVKY HHHCCCCHHHHHHHH | 29.20 | 22802335 | |
| 184 | Phosphorylation | ASLVKYYYSWKKTRS HHHHHHHHHCHHCCC | 12.64 | 22802335 | |
| 185 | Phosphorylation | SLVKYYYSWKKTRSR HHHHHHHHCHHCCCC | 19.12 | - | |
| 212 | Phosphorylation | NRHNQGDSDDDVEEA HHCCCCCCCCCHHHH | 50.17 | 25521595 | |
| 227 | Phosphorylation | HPMDGNDSDYDPKKE CCCCCCCCCCCHHHH | 41.91 | 25521595 | |
| 229 | Phosphorylation | MDGNDSDYDPKKEAK CCCCCCCCCHHHHHH | 37.79 | 25521595 | |
| 259 | Phosphorylation | LGRREYQSLQHRHHS CCHHHHHHHHHHHHH | 29.15 | 29176673 | |
| 396 | Dimethylation | PPLQQQARFIQPRPT CCHHHHHHHCCCCCC | 25.51 | - | |
| 396 | Methylation | PPLQQQARFIQPRPT CCHHHHHHHCCCCCC | 25.51 | 18966631 | |
| 401 | Asymmetric dimethylarginine | QARFIQPRPTLNQPP HHHHCCCCCCCCCCC | 22.06 | - | |
| 401 | Methylation | QARFIQPRPTLNQPP HHHHCCCCCCCCCCC | 22.06 | 24129315 | |
| 413 | Asymmetric dimethylarginine | QPPPPLIRPANSMPP CCCCCCCCCCCCCCC | 31.77 | - | |
| 413 | Methylation | QPPPPLIRPANSMPP CCCCCCCCCCCCCCC | 31.77 | 24129315 | |
| 421 | Methylation | PANSMPPRLNPRPVL CCCCCCCCCCCCCEE | 41.02 | 54541289 | |
| 421 | Dimethylation | PANSMPPRLNPRPVL CCCCCCCCCCCCCEE | 41.02 | - |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RCOR3_MOUSE !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RCOR3_MOUSE !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RCOR3_MOUSE !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of RCOR3_MOUSE !! | ||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...