UniProt ID | RCOR3_MOUSE | |
---|---|---|
UniProt AC | Q6PGA0 | |
Protein Name | REST corepressor 3 | |
Gene Name | Rcor3 | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 451 | |
Subcellular Localization | Nucleus . | |
Protein Description | May act as a component of a corepressor complex that represses transcription.. | |
Protein Sequence | MPGMMEKGPELLGKSRSANGGAKSPAGGGGSSANGGLHFSEPESGCSSDDEHGDVGMRVGAEYQARIPEFDPGATKYTDKDNGGMLVWSPYHSIPDAKLDEYIAIAKEKHGYNVEQALGMLFWHKHNIEKSLADLPNFTPFPDEWTVEDKVLFEQAFSFHGKSFHRIQQMLPDKTIASLVKYYYSWKKTRSRTSLMDRQARKLANRHNQGDSDDDVEEAHPMDGNDSDYDPKKEAKREGNADQPVQTSKIGLGRREYQSLQHRHHSQRSKCRPPKGMYLTQEDVVAVSCSPNAANTILRQLDMELISLKRQVQNAKQVNSALKQKMEGGIEEFKPPEAQTPQAPRTLGPSPPAPSSTPTPTVPIATLNQPPPLLRPTLPAAPALHRQPPPLQQQARFIQPRPTLNQPPPPLIRPANSMPPRLNPRPVLTTVGGQQPPSLIGIQTDSQPSLH | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
24 | Phosphorylation | SANGGAKSPAGGGGS CCCCCCCCCCCCCCC | 21.32 | - | |
40 | Phosphorylation | ANGGLHFSEPESGCS CCCCCCCCCCCCCCC | 41.30 | 21082442 | |
47 | Phosphorylation | SEPESGCSSDDEHGD CCCCCCCCCCCCCCC | 40.08 | 21082442 | |
107 | Ubiquitination | DEYIAIAKEKHGYNV HHHHHHHHHHCCCCH | 62.27 | - | |
175 | Phosphorylation | QQMLPDKTIASLVKY HHHCCCCHHHHHHHH | 29.20 | 22802335 | |
184 | Phosphorylation | ASLVKYYYSWKKTRS HHHHHHHHHCHHCCC | 12.64 | 22802335 | |
185 | Phosphorylation | SLVKYYYSWKKTRSR HHHHHHHHCHHCCCC | 19.12 | - | |
212 | Phosphorylation | NRHNQGDSDDDVEEA HHCCCCCCCCCHHHH | 50.17 | 25521595 | |
227 | Phosphorylation | HPMDGNDSDYDPKKE CCCCCCCCCCCHHHH | 41.91 | 25521595 | |
229 | Phosphorylation | MDGNDSDYDPKKEAK CCCCCCCCCHHHHHH | 37.79 | 25521595 | |
259 | Phosphorylation | LGRREYQSLQHRHHS CCHHHHHHHHHHHHH | 29.15 | 29176673 | |
396 | Dimethylation | PPLQQQARFIQPRPT CCHHHHHHHCCCCCC | 25.51 | - | |
396 | Methylation | PPLQQQARFIQPRPT CCHHHHHHHCCCCCC | 25.51 | 18966631 | |
401 | Asymmetric dimethylarginine | QARFIQPRPTLNQPP HHHHCCCCCCCCCCC | 22.06 | - | |
401 | Methylation | QARFIQPRPTLNQPP HHHHCCCCCCCCCCC | 22.06 | 24129315 | |
413 | Asymmetric dimethylarginine | QPPPPLIRPANSMPP CCCCCCCCCCCCCCC | 31.77 | - | |
413 | Methylation | QPPPPLIRPANSMPP CCCCCCCCCCCCCCC | 31.77 | 24129315 | |
421 | Methylation | PANSMPPRLNPRPVL CCCCCCCCCCCCCEE | 41.02 | 54541289 | |
421 | Dimethylation | PANSMPPRLNPRPVL CCCCCCCCCCCCCEE | 41.02 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RCOR3_MOUSE !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RCOR3_MOUSE !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RCOR3_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of RCOR3_MOUSE !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...