UniProt ID | RCN3_MOUSE | |
---|---|---|
UniProt AC | Q8BH97 | |
Protein Name | Reticulocalbin-3 | |
Gene Name | Rcn3 | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 328 | |
Subcellular Localization | Endoplasmic reticulum lumen . | |
Protein Description | ||
Protein Sequence | MMWRWSFLLLLLLLRHWALGKPSPDAGPHGQDRVHHGTPLSEAPHDDAHGNFQYDHEAFLGRDVAKEFDKLSPEESQARLGRIVDRMDLAGDSDGWVSLAELRAWIAHTQQRHIRDSVSAAWHTYDTDRDGRVGWEELRNATYGHYEPGEEFHDVEDAETYKKMLARDERRFRVADQDGDSMATREELTAFLHPEEFPHMRDIVVAETLEDLDKNKDGYVQVEEYIADLYSEEPGEEEPAWVQTERQQFREFRDLNKDGRLDGSEVGYWVLPPSQDQPLVEANHLLHESDTDKDGRLSKAEILSNWNMFVGSQATNYGEDLTRHHDEL | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
70 | Ubiquitination | DVAKEFDKLSPEESQ HHHHHHHHCCHHHHH | 57.07 | - | |
70 | Acetylation | DVAKEFDKLSPEESQ HHHHHHHHCCHHHHH | 57.07 | 23806337 | |
70 | Succinylation | DVAKEFDKLSPEESQ HHHHHHHHCCHHHHH | 57.07 | 23806337 | |
72 | Phosphorylation | AKEFDKLSPEESQAR HHHHHHCCHHHHHHH | 35.69 | 28066266 | |
76 | Phosphorylation | DKLSPEESQARLGRI HHCCHHHHHHHHHHH | 27.72 | 28066266 | |
93 | Phosphorylation | RMDLAGDSDGWVSLA HHHHCCCCCCCEEHH | 36.79 | 26525534 | |
127 | Phosphorylation | AAWHTYDTDRDGRVG HHHCCCCCCCCCCCC | 23.63 | 26525534 | |
140 | N-linked_Glycosylation | VGWEELRNATYGHYE CCHHHHHHCCCCCCC | 49.62 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RCN3_MOUSE !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RCN3_MOUSE !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RCN3_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of RCN3_MOUSE !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...