| UniProt ID | RCN1_MOUSE | |
|---|---|---|
| UniProt AC | Q05186 | |
| Protein Name | Reticulocalbin-1 | |
| Gene Name | Rcn1 | |
| Organism | Mus musculus (Mouse). | |
| Sequence Length | 325 | |
| Subcellular Localization | Endoplasmic reticulum lumen. | |
| Protein Description | May regulate calcium-dependent activities in the endoplasmic reticulum lumen or post-ER compartment.. | |
| Protein Sequence | MARGGRLGLALGLLLALVLALRAKPTVRKERVVRPDSELGERPPEDNQSFQYDHEAFLGKEDSKTFDQLSPDESKERLGKIVDRIDSDGDGLVTTEELKLWIKRVQKRYIYDNVAKVWKDYDRDKDEKISWEEYKQATYGYYLGNPAEFHDSSDHHTFKKMLPRDERRFKASDLDGDLTATREEFTAFLHPEEFEHMKEIVVLETLEDIDKNGDGFVDQDEYIADMFSHEDNGPEPDWVLSEREQFNDFRDLNKDGKLDKDEIRHWILPQDYDHAQAEARHLVYESDKNKDEMLTKEEILDNWNMFVGSQATNYGEDLTKNHDEL | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 47 | N-linked_Glycosylation | GERPPEDNQSFQYDH CCCCCCCCCCCCCCH | 37.42 | - | |
| 49 | Phosphorylation | RPPEDNQSFQYDHEA CCCCCCCCCCCCHHH | 22.14 | - | |
| 65 | Phosphorylation | LGKEDSKTFDQLSPD CCCCCCCCHHHCCCH | 36.07 | 25159016 | |
| 70 | Phosphorylation | SKTFDQLSPDESKER CCCHHHCCCHHHHHH | 25.36 | 26160508 | |
| 74 | Phosphorylation | DQLSPDESKERLGKI HHCCCHHHHHHHHHH | 47.39 | 25159016 | |
| 87 | Phosphorylation | KIVDRIDSDGDGLVT HHHHHHCCCCCCCCC | 40.91 | 26525534 | |
| 142 | Phosphorylation | KQATYGYYLGNPAEF HHHHCCCCCCCHHHC | 12.08 | - | |
| 284 | Phosphorylation | AEARHLVYESDKNKD HHHHHHHHHCCCCHH | 18.97 | 22817900 | |
| 286 | Phosphorylation | ARHLVYESDKNKDEM HHHHHHHCCCCHHHC | 35.88 | 26525534 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RCN1_MOUSE !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RCN1_MOUSE !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RCN1_MOUSE !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of RCN1_MOUSE !! | ||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...