UniProt ID | RCN1_MOUSE | |
---|---|---|
UniProt AC | Q05186 | |
Protein Name | Reticulocalbin-1 | |
Gene Name | Rcn1 | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 325 | |
Subcellular Localization | Endoplasmic reticulum lumen. | |
Protein Description | May regulate calcium-dependent activities in the endoplasmic reticulum lumen or post-ER compartment.. | |
Protein Sequence | MARGGRLGLALGLLLALVLALRAKPTVRKERVVRPDSELGERPPEDNQSFQYDHEAFLGKEDSKTFDQLSPDESKERLGKIVDRIDSDGDGLVTTEELKLWIKRVQKRYIYDNVAKVWKDYDRDKDEKISWEEYKQATYGYYLGNPAEFHDSSDHHTFKKMLPRDERRFKASDLDGDLTATREEFTAFLHPEEFEHMKEIVVLETLEDIDKNGDGFVDQDEYIADMFSHEDNGPEPDWVLSEREQFNDFRDLNKDGKLDKDEIRHWILPQDYDHAQAEARHLVYESDKNKDEMLTKEEILDNWNMFVGSQATNYGEDLTKNHDEL | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
47 | N-linked_Glycosylation | GERPPEDNQSFQYDH CCCCCCCCCCCCCCH | 37.42 | - | |
49 | Phosphorylation | RPPEDNQSFQYDHEA CCCCCCCCCCCCHHH | 22.14 | - | |
65 | Phosphorylation | LGKEDSKTFDQLSPD CCCCCCCCHHHCCCH | 36.07 | 25159016 | |
70 | Phosphorylation | SKTFDQLSPDESKER CCCHHHCCCHHHHHH | 25.36 | 26160508 | |
74 | Phosphorylation | DQLSPDESKERLGKI HHCCCHHHHHHHHHH | 47.39 | 25159016 | |
87 | Phosphorylation | KIVDRIDSDGDGLVT HHHHHHCCCCCCCCC | 40.91 | 26525534 | |
142 | Phosphorylation | KQATYGYYLGNPAEF HHHHCCCCCCCHHHC | 12.08 | - | |
284 | Phosphorylation | AEARHLVYESDKNKD HHHHHHHHHCCCCHH | 18.97 | 22817900 | |
286 | Phosphorylation | ARHLVYESDKNKDEM HHHHHHHCCCCHHHC | 35.88 | 26525534 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RCN1_MOUSE !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RCN1_MOUSE !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RCN1_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of RCN1_MOUSE !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...