RCL1_DROME - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: RCL1_DROME
• UniProt AC: P56175
• Protein Name: Probable RNA 3'-terminal phosphate cyclase-like protein
• Gene Name: Rtc1
• Organism: Drosophila melanogaster (Fruit fly).
• Sequence Length: 384
• Subcellular Localization: Nucleus, nucleolus.
• Protein Description: Does not have cyclase activity. Plays a role in 40S-ribosomal-subunit biogenesis in the early pre-rRNA processing steps at sites A0, A1 and A2 that are required for proper maturation of the 18S RNA (By similarity)..
• Protein Sequence: MPPIAQEGNCLIYRGSNFLKQRLILACLSGKPVKISQIRSEDETAPGLREYEISLIRLLDKITNGTKIELNPAGTSVMFSPGLLHGGQLNHDCCVQRGIGYYLDALIALGPFCKSPLQCTLRGVTNSKDSPSVDHIKGAALSLLKRFLLVDEGLELKVVRRGVAPLGGGEIIFRCPVRKSLRAIQFQSQGMVKRIRGTVYACKVSPAMANRTVEAAKGCMLKFLPDVYIYTDQNKGKMSGNSPGFGICLIAETTDGVCFAADCCSNTREESEDTPSIPENLGKEVALRLLDEIYRGGCVDSSYQWLAALYIALGQKHVSKFLTGALSNYTVHFLQHLRDFFSITFKLENPEAEDEDEAENVRGAQKVLMACVGIGYTNINKRVI

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
51	Phosphorylation	TAPGLREYEISLIRL CCCCCCHHHHHHHHH	16.48	22817900

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of RCL1_DROME !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of RCL1_DROME !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of RCL1_DROME !!

Protein-Protein Interaction

Oops, there are no PPI records of RCL1_DROME !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.