RBS1B_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: RBS1B_ARATH
• UniProt AC: P10796
• Protein Name: Ribulose bisphosphate carboxylase small chain 1B, chloroplastic
• Gene Name: RBCS-1B
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 181
• Subcellular Localization: Plastid, chloroplast membrane ; Peripheral membrane protein . Plastid, chloroplast stroma .
• Protein Description: RuBisCO catalyzes two reactions: the carboxylation of D-ribulose 1,5-bisphosphate, the primary event in carbon dioxide fixation, as well as the oxidative fragmentation of the pentose substrate. Both reactions occur simultaneously and in competition at the same active site (By similarity)..
• Protein Sequence: MASSMLSSAAVVTSPAQATMVAPFTGLKSSASFPVTRKANNDITSITSNGGRVSCMKVWPPIGKKKFETLSYLPDLTDVELAKEVDYLLRNKWIPCVEFELEHGFVYREHGNTPGYYDGRYWTMWKLPLFGCTDSAQVLKEVEECKKEYPGAFIRIIGFDNTRQVQCISFIAYKPPSFTDA

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
25	Phosphorylation	ATMVAPFTGLKSSAS EEEEECCCCCCCCCC	40.31	24243849
30	Phosphorylation	PFTGLKSSASFPVTR CCCCCCCCCCCCCEE	26.75	25561503
32	Phosphorylation	TGLKSSASFPVTRKA CCCCCCCCCCCEEEC	31.84	25561503
36	Phosphorylation	SSASFPVTRKANNDI CCCCCCCEEECCCCC	27.04	25561503
69	Phosphorylation	IGKKKFETLSYLPDL CCCCEEEEECCCCCC	24.92	22092075
87	Phosphorylation	ELAKEVDYLLRNKWI HHHHHHHHHHHCCCC	16.89	29654922
92	Acetylation	VDYLLRNKWIPCVEF HHHHHHCCCCCEEEE	39.81	21311030
113	Phosphorylation	VYREHGNTPGYYDGR EEEEECCCCCCCCCC	23.76	29654922
133	Phosphorylation	KLPLFGCTDSAQVLK EEEECCCCCHHHHHH	33.11	30291188
135	Phosphorylation	PLFGCTDSAQVLKEV EECCCCCHHHHHHHH	11.49	30291188
149	Phosphorylation	VEECKKEYPGAFIRI HHHHHHHCCCCEEEE	18.82	19880383
162	Phosphorylation	RIIGFDNTRQVQCIS EEEEECCCCEEEEEE	25.07	30291188
177	Phosphorylation	FIAYKPPSFTDA--- EEEECCCCCCCC---	49.67	29654922

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of RBS1B_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of RBS1B_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of RBS1B_ARATH !!

Protein-Protein Interaction

Oops, there are no PPI records of RBS1B_ARATH !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.