RBM8A_RAT - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: RBM8A_RAT
• UniProt AC: Q27W01
• Protein Name: RNA-binding protein 8A
• Gene Name: Rbm8a
• Organism: Rattus norvegicus (Rat).
• Sequence Length: 174
• Subcellular Localization: Nucleus. Nucleus speckle. Cytoplasm. Nucleocytoplasmic shuttling protein. Travels to the cytoplasm as part of the exon junction complex (EJC) bound to mRNA. Colocalizes with the core EJC, ALYREF/THOC4, NXF1 and UAP56 in the nucleus and nuclear speckl
• Protein Description: Core component of the splicing-dependent multiprotein exon junction complex (EJC) deposited at splice junctions on mRNAs. The EJC is a dynamic structure consisting of core proteins and several peripheral nuclear and cytoplasmic associated factors that join the complex only transiently either during EJC assembly or during subsequent mRNA metabolism. The EJC marks the position of the exon-exon junction in the mature mRNA for the gene expression machinery and the core components remain bound to spliced mRNAs throughout all stages of mRNA metabolism thereby influencing downstream processes including nuclear mRNA export, subcellular mRNA localization, translation efficiency and nonsense-mediated mRNA decay (NMD). The MAGOH-RBM8A heterodimer inhibits the ATPase activity of EIF4A3, thereby trapping the ATP-bound EJC core onto spliced mRNA in a stable conformation. The MAGOH-RBM8A heterodimer interacts with the EJC key regulator PYM1 leading to EJC disassembly in the cytoplasm and translation enhancement of EJC-bearing spliced mRNAs by recruiting them to the ribosomal 48S preinitiation complex. Its removal from cytoplasmic mRNAs requires translation initiation from EJC-bearing spliced mRNAs. Associates preferentially with mRNAs produced by splicing. Does not interact with pre-mRNAs, introns, or mRNAs produced from intronless cDNAs. Associates with both nuclear mRNAs and newly exported cytoplasmic mRNAs. The MAGOH-RBM8A heterodimer is a component of the nonsense mediated decay (NMD) pathway. Involved in the splicing modulation of BCL2L1/Bcl-X (and probably other apoptotic genes); specifically inhibits formation of proapoptotic isoforms; the function is different from the established EJC assembly (By similarity)..
• Protein Sequence: MADVLDLHEAGGEDFAMDEDGDESIHKLKEKAKKRKGRGFGSEEGSRARMREDYDSVEQDGDEPGPQRSVEGWILFVTGVHEEATEEDIHDKFAEYGEIKNIHLNLDRRTGYLKGYTLVEYETYKEAQAAMEGLNGQDLMGQPISVDWCFVRGPPKGKRRGGRRRSRSPDRRRR

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
2	Acetylation	------MADVLDLHE ------CCCCCCHHH	18.67	-
24	Phosphorylation	MDEDGDESIHKLKEK CCCCCCHHHHHHHHH	34.43	23298284
42	Phosphorylation	RKGRGFGSEEGSRAR HCCCCCCCHHHHHHH	30.16	29779826
46	Phosphorylation	GFGSEEGSRARMRED CCCCHHHHHHHHHHC	26.50	28432305
54	Phosphorylation	RARMREDYDSVEQDG HHHHHHCHHHCCCCC	12.83	27097102
56	Phosphorylation	RMREDYDSVEQDGDE HHHHCHHHCCCCCCC	22.71	23712012
166	Phosphorylation	RRGGRRRSRSPDRRR CCCCCCCCCCCCCCC	34.99	22673903
168	Phosphorylation	GGRRRSRSPDRRRR- CCCCCCCCCCCCCC-	32.19	22673903

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of RBM8A_RAT !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of RBM8A_RAT !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of RBM8A_RAT !!

Protein-Protein Interaction

Oops, there are no PPI records of RBM8A_RAT !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.