UniProt ID | RB47A_ARATH | |
---|---|---|
UniProt AC | F4I3B3 | |
Protein Name | Polyadenylate-binding protein RBP47A | |
Gene Name | RBP47A | |
Organism | Arabidopsis thaliana (Mouse-ear cress). | |
Sequence Length | 445 | |
Subcellular Localization | Nucleus. Cytoplasmic granule. | |
Protein Description | Heterogeneous nuclear ribonucleoprotein (hnRNP)-protein binding the poly(A) tail of mRNA and probably involved in some steps of pre-mRNA maturation.. | |
Protein Sequence | MQTPNNNGSTDSVLPPTSAGTTPPPPLQQSTPPPQQQQQQQWQQQQQWMAAMQQYPAAAMAMMQQQQMMMYPHPQYAPYNQAAYQQHPQFQYAAYQQQQQQHHQSQQQPRGGSGGDDVKTLWVGDLLHWMDETYLHTCFSHTNEVSSVKVIRNKQTCQSEGYGFVEFLSRSAAEEALQSFSGVTMPNAEQPFRLNWASFSTGEKRASENGPDLSIFVGDLAPDVSDAVLLETFAGRYPSVKGAKVVIDSNTGRSKGYGFVRFGDENERSRAMTEMNGAFCSSRQMRVGIATPKRAAAYGQQNGSQALTLAGGHGGNGSMSDGESNNSTIFVGGLDADVTEEDLMQPFSDFGEVVSVKIPVGKGCGFVQFANRQSAEEAIGNLNGTVIGKNTVRLSWGRSPNKQWRSDSGNQWNGGYSRGQGYNNGYANQDSNMYATAAAAVPGAS | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
291 | Phosphorylation | QMRVGIATPKRAAAY CCEEEECCHHHHHHH | 27.67 | 19880383 | |
385 | Phosphorylation | AIGNLNGTVIGKNTV HHCCCCCEEEECCEE | 14.10 | 25561503 | |
395 | Phosphorylation | GKNTVRLSWGRSPNK ECCEEEEEECCCCCC | 19.54 | 27643528 | |
399 | Phosphorylation | VRLSWGRSPNKQWRS EEEEECCCCCCCCCC | 28.96 | 30589143 | |
406 | Phosphorylation | SPNKQWRSDSGNQWN CCCCCCCCCCCCCCC | 32.92 | 23776212 | |
408 | Phosphorylation | NKQWRSDSGNQWNGG CCCCCCCCCCCCCCC | 40.67 | 23776212 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RB47A_ARATH !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RB47A_ARATH !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RB47A_ARATH !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of RB47A_ARATH !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...