| UniProt ID | RB47A_ARATH | |
|---|---|---|
| UniProt AC | F4I3B3 | |
| Protein Name | Polyadenylate-binding protein RBP47A | |
| Gene Name | RBP47A | |
| Organism | Arabidopsis thaliana (Mouse-ear cress). | |
| Sequence Length | 445 | |
| Subcellular Localization | Nucleus. Cytoplasmic granule. | |
| Protein Description | Heterogeneous nuclear ribonucleoprotein (hnRNP)-protein binding the poly(A) tail of mRNA and probably involved in some steps of pre-mRNA maturation.. | |
| Protein Sequence | MQTPNNNGSTDSVLPPTSAGTTPPPPLQQSTPPPQQQQQQQWQQQQQWMAAMQQYPAAAMAMMQQQQMMMYPHPQYAPYNQAAYQQHPQFQYAAYQQQQQQHHQSQQQPRGGSGGDDVKTLWVGDLLHWMDETYLHTCFSHTNEVSSVKVIRNKQTCQSEGYGFVEFLSRSAAEEALQSFSGVTMPNAEQPFRLNWASFSTGEKRASENGPDLSIFVGDLAPDVSDAVLLETFAGRYPSVKGAKVVIDSNTGRSKGYGFVRFGDENERSRAMTEMNGAFCSSRQMRVGIATPKRAAAYGQQNGSQALTLAGGHGGNGSMSDGESNNSTIFVGGLDADVTEEDLMQPFSDFGEVVSVKIPVGKGCGFVQFANRQSAEEAIGNLNGTVIGKNTVRLSWGRSPNKQWRSDSGNQWNGGYSRGQGYNNGYANQDSNMYATAAAAVPGAS | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 291 | Phosphorylation | QMRVGIATPKRAAAY CCEEEECCHHHHHHH | 27.67 | 19880383 | |
| 385 | Phosphorylation | AIGNLNGTVIGKNTV HHCCCCCEEEECCEE | 14.10 | 25561503 | |
| 395 | Phosphorylation | GKNTVRLSWGRSPNK ECCEEEEEECCCCCC | 19.54 | 27643528 | |
| 399 | Phosphorylation | VRLSWGRSPNKQWRS EEEEECCCCCCCCCC | 28.96 | 30589143 | |
| 406 | Phosphorylation | SPNKQWRSDSGNQWN CCCCCCCCCCCCCCC | 32.92 | 23776212 | |
| 408 | Phosphorylation | NKQWRSDSGNQWNGG CCCCCCCCCCCCCCC | 40.67 | 23776212 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RB47A_ARATH !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RB47A_ARATH !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RB47A_ARATH !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of RB47A_ARATH !! | ||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
