RB27B_MOUSE - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: RB27B_MOUSE
• UniProt AC: Q99P58
• Protein Name: Ras-related protein Rab-27B
• Gene Name: Rab27b
• Organism: Mus musculus (Mouse).
• Sequence Length: 218
• Subcellular Localization: Membrane; Lipid-anchor.
• Protein Description: May be involved in targeting uroplakins to urothelial apical membranes..
• Protein Sequence: MTDGDYDYLIKLLALGDSGVGKTTFLYRYTDNKFNPKFITTVGIDFREKRVVYDTQGADGASGKAFKVHLQLWDTAGQERFRSLTTAFFRDAMGFLLMFDLTSQQSFLNVRNWMSQLQANAYCENPDIVLIGNKADLPDQREVNERQARELAEKYGIPYFETSAATGQNVEKSVETLLDLIMKRMEKCVEKTQVPDTVNGGNSGKLDGEKPAEKKCAC

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
2	Acetylation	------MTDGDYDYL ------CCCCCHHHH	49.00	-
62	Phosphorylation	TQGADGASGKAFKVH CCCCCCCCCCEEEEE	46.48	29899451
216	Geranylgeranylation	EKPAEKKCAC----- CCCCCCCCCC-----	7.47	-
218	Methylation	PAEKKCAC------- CCCCCCCC-------	8.86	-
218	Geranylgeranylation	PAEKKCAC------- CCCCCCCC-------	8.86	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of RB27B_MOUSE !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of RB27B_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of RB27B_MOUSE !!

Protein-Protein Interaction

Oops, there are no PPI records of RB27B_MOUSE !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.