| UniProt ID | RB27A_MOUSE | |
|---|---|---|
| UniProt AC | Q9ERI2 | |
| Protein Name | Ras-related protein Rab-27A | |
| Gene Name | Rab27a | |
| Organism | Mus musculus (Mouse). | |
| Sequence Length | 221 | |
| Subcellular Localization |
Membrane Lipid-anchor . Melanosome . Late endosome . Lysosome . Identified by mass spectrometry in melanosome fractions from stage I to stage IV. Localizes to endosomal exocytic vesicles. |
|
| Protein Description | Plays a role in cytotoxic granule exocytosis in lymphocytes. Required for both granule maturation and granule docking and priming at the immunologic synapse (By similarity).. | |
| Protein Sequence | MSDGDYDYLIKFLALGDSGVGKTSVLYQYTDGKFNSKFITTVGIDFREKRVVYRANGPDGAVGRGQRIHLQLWDTAGQERFRSLTTAFFRDAMGFLLLFDLTNEQSFLNVRNWISQLQMHAYCENPDIVLCGNKSDLEDQRAVKEEEARELAEKYGIPYFETSAANGTNISHAIEMLLDLIMKRMERCVDKSWIPEGVVRSNGHTSADQLSEEKEKGLCGC | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 2 | Acetylation | ------MSDGDYDYL ------CCCCCHHHH | 50.75 | - | |
| 2 | Phosphorylation | ------MSDGDYDYL ------CCCCCHHHH | 50.75 | - | |
| 64 | Methylation | GPDGAVGRGQRIHLQ CCCCCCCCCCEEEEE | 31.32 | 16289445 | |
| 201 | Phosphorylation | IPEGVVRSNGHTSAD CCCCCCCCCCCCCHH | 35.24 | 19367708 | |
| 205 | Phosphorylation | VVRSNGHTSADQLSE CCCCCCCCCHHHCCH | 27.32 | 22802335 | |
| 206 | Phosphorylation | VRSNGHTSADQLSEE CCCCCCCCHHHCCHH | 24.95 | 22817900 | |
| 211 | Phosphorylation | HTSADQLSEEKEKGL CCCHHHCCHHHHHCC | 37.77 | 22817900 | |
| 219 | Geranylgeranylation | EEKEKGLCGC----- HHHHHCCCCC----- | 7.73 | - | |
| 221 | Methylation | KEKGLCGC------- HHHCCCCC------- | 5.00 | - | |
| 221 | Geranylgeranylation | KEKGLCGC------- HHHCCCCC------- | 5.00 | - |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RB27A_MOUSE !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RB27A_MOUSE !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RB27A_MOUSE !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| MYO5A_MOUSE | Myo5a | physical | 11266470 | |
| MELPH_MOUSE | Mlph | physical | 11887186 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
| Phosphorylation | |
| Reference | PubMed |
| "Solid tumor proteome and phosphoproteome analysis by high resolutionmass spectrometry."; Zanivan S., Gnad F., Wickstroem S.A., Geiger T., Macek B., Cox J.,Faessler R., Mann M.; J. Proteome Res. 7:5314-5326(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-211, AND MASSSPECTROMETRY. | |
