| UniProt ID | RB22A_MOUSE | |
|---|---|---|
| UniProt AC | P35285 | |
| Protein Name | Ras-related protein Rab-22A | |
| Gene Name | Rab22a | |
| Organism | Mus musculus (Mouse). | |
| Sequence Length | 194 | |
| Subcellular Localization |
Endosome membrane Lipid-anchor . Cell membrane Lipid-anchor . Early endosome . Late endosome . Cell projection, ruffle . Cytoplasmic vesicle . Cytoplasmic vesicle, phagosome . Cytoplasmic vesicle, phagosome membrane Lipid-anchor Cytoplasmic side . |
|
| Protein Description | Plays a role in endocytosis and intracellular protein transport. [PubMed: 19759177] | |
| Protein Sequence | MALRELKVCLLGDTGVGKSSIVWRFVEDSFDPNINPTIGASFMTKTVQYQNELHKFLIWDTAGQERFRALAPMYYRGSAAAIIVYDITKEETFSTLKNWVRELRQHGPPSIVVAIAGNKCDLTDVREVMERDAKDYADSIHAIFVETSAKNAININELFIEISRRIPSTDANPASGGKGFKLRRQPSEPKRSCC | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 9 | S-nitrosocysteine | ALRELKVCLLGDTGV CCCCCEEEEECCCCC | 2.19 | - | |
| 9 | S-nitrosylation | ALRELKVCLLGDTGV CCCCCEEEEECCCCC | 2.19 | 20925432 | |
| 78 | Phosphorylation | APMYYRGSAAAIIVY HHCCCCCCEEEEEEE | 13.02 | 22871156 | |
| 92 | Phosphorylation | YDITKEETFSTLKNW EECCCHHHHHHHHHH | 24.79 | 22871156 | |
| 175 | Phosphorylation | STDANPASGGKGFKL CCCCCCCCCCCCCCC | 49.70 | 23684622 | |
| 187 | Phosphorylation | FKLRRQPSEPKRSCC CCCCCCCCCCCCCCC | 59.18 | 25521595 | |
| 193 | Geranylgeranylation | PSEPKRSCC------ CCCCCCCCC------ | 3.56 | - | |
| 194 | Geranylgeranylation | SEPKRSCC------- CCCCCCCC------- | 7.05 | - |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RB22A_MOUSE !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RB22A_MOUSE !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RB22A_MOUSE !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of RB22A_MOUSE !! | ||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
