| UniProt ID | RASN_RAT | |
|---|---|---|
| UniProt AC | Q04970 | |
| Protein Name | GTPase NRas | |
| Gene Name | Nras | |
| Organism | Rattus norvegicus (Rat). | |
| Sequence Length | 189 | |
| Subcellular Localization |
Cell membrane Lipid-anchor Cytoplasmic side . Golgi apparatus membrane Lipid-anchor . Shuttles between the plasma membrane and the Golgi apparatus. |
|
| Protein Description | Ras proteins bind GDP/GTP and possess intrinsic GTPase activity.. | |
| Protein Sequence | MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNSKSFADINLYREQIKRVKDSDDVPMVLVGNKCDLPTRTVDTKQAHELAKSYGIPFIETSAKTRQGVEDAFYTLVREIRQYRMKKLNSSEDGTQGCMGLPCVVM | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 39 | Phosphorylation | YDPTIEDSYRKQVVI CCCCCCHHHCCEEEE | 17.66 | 30181290 | |
| 89 | Phosphorylation | FAINNSKSFADINLY EEECCCCCHHHHHHH | 26.03 | - | |
| 181 | S-palmitoylation | SEDGTQGCMGLPCVV CCCCCCCCCCCCEEE | 1.09 | - | |
| 186 | Methylation | QGCMGLPCVVM---- CCCCCCCEEEC---- | 4.30 | - | |
| 186 | Farnesylation | QGCMGLPCVVM---- CCCCCCCEEEC---- | 4.30 | - |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RASN_RAT !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference |
|---|---|---|---|---|
| 89 | S | Phosphorylation |
| - |
| 104 | K | Acetylation |
| - |
| 170 | K | ubiquitylation |
| - |
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RASN_RAT !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of RASN_RAT !! | ||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...