UniProt ID | RASN_RAT | |
---|---|---|
UniProt AC | Q04970 | |
Protein Name | GTPase NRas | |
Gene Name | Nras | |
Organism | Rattus norvegicus (Rat). | |
Sequence Length | 189 | |
Subcellular Localization |
Cell membrane Lipid-anchor Cytoplasmic side . Golgi apparatus membrane Lipid-anchor . Shuttles between the plasma membrane and the Golgi apparatus. |
|
Protein Description | Ras proteins bind GDP/GTP and possess intrinsic GTPase activity.. | |
Protein Sequence | MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNSKSFADINLYREQIKRVKDSDDVPMVLVGNKCDLPTRTVDTKQAHELAKSYGIPFIETSAKTRQGVEDAFYTLVREIRQYRMKKLNSSEDGTQGCMGLPCVVM | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
39 | Phosphorylation | YDPTIEDSYRKQVVI CCCCCCHHHCCEEEE | 17.66 | 30181290 | |
89 | Phosphorylation | FAINNSKSFADINLY EEECCCCCHHHHHHH | 26.03 | - | |
181 | S-palmitoylation | SEDGTQGCMGLPCVV CCCCCCCCCCCCEEE | 1.09 | - | |
186 | Methylation | QGCMGLPCVVM---- CCCCCCCEEEC---- | 4.30 | - | |
186 | Farnesylation | QGCMGLPCVVM---- CCCCCCCEEEC---- | 4.30 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RASN_RAT !! |
Modified Location | Modified Residue | Modification | Function | Reference |
---|---|---|---|---|
89 | S | Phosphorylation |
| - |
104 | K | Acetylation |
| - |
170 | K | ubiquitylation |
| - |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RASN_RAT !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of RASN_RAT !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...