UniProt ID | RAPSN_MOUSE | |
---|---|---|
UniProt AC | P12672 | |
Protein Name | 43 kDa receptor-associated protein of the synapse | |
Gene Name | Rapsn | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 412 | |
Subcellular Localization |
Cell membrane Peripheral membrane protein Cytoplasmic side. Cell junction, synapse, postsynaptic cell membrane Peripheral membrane protein Cytoplasmic side. Cytoplasm, cytoskeleton. Cytoplasmic surface of postsynaptic membranes. |
|
Protein Description | Postsynaptic protein required for clustering of nicotinic acetylcholine receptors (nAChRs) at the neuromuscular junction. It may link the receptor to the underlying postsynaptic cytoskeleton, possibly by direct association with actin or spectrin (By similarity).. | |
Protein Sequence | MGQDQTKQQIEKGLQLYQSNQTEKALQVWMKVLEKGSDLVGRFRVLGCLVTAHSEMGRYKEMLKFAVVQIDTARGLEDADFLLESYLNLARSNEKLCEFHKTISYCKTCLGLPGTRAGAQLGGQVSLSMGNAFLGLSLFQKALESFEKALRYAHNNDDTMLECRVCCSLGSFYAQVKDYEKALFFPCKAAELVNDYGKGWSLKYRAMSQYHMAVAYRLLGHLGSAMECCEESMKIALQHGDRPLQALCLLCFADIHRSRGDLETAFPRYDSAMSIMTEIGNRLGQVHVLLGVAKCWMARKVQDKALDAIEKAQDLAEEVGNKLSQLKLHCLSESIYRSKGLQRELRTHVVRFHECVEETELYCGLCGESIGERNSRLQALPCSHIFHLRCLQNNGTRSCPNCRRSSMKPGFV | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Myristoylation | ------MGQDQTKQQ ------CCCHHHHHH | 39.51 | - | |
196 | Phosphorylation | AAELVNDYGKGWSLK HHHHHCCCCCCCCCH | 18.61 | - | |
224 | Phosphorylation | RLLGHLGSAMECCEE HHHHHHHHHHHHHHH | 30.70 | - | |
405 | Phosphorylation | SCPNCRRSSMKPGFV CCCCCCCCCCCCCCC | 18.55 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RAPSN_MOUSE !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RAPSN_MOUSE !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RAPSN_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of RAPSN_MOUSE !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...