| UniProt ID | RAP2C_MOUSE | |
|---|---|---|
| UniProt AC | Q8BU31 | |
| Protein Name | Ras-related protein Rap-2c | |
| Gene Name | Rap2c | |
| Organism | Mus musculus (Mouse). | |
| Sequence Length | 183 | |
| Subcellular Localization |
Cytoplasm. Recycling endosome membrane Lipid-anchor Cytoplasmic side . |
|
| Protein Description | Small GTP-binding protein which cycles between a GDP-bound inactive and a GTP-bound active form. May play a role in cytoskeletal rearrangements and regulate cell spreading through activation of the effector TNIK. May play a role in SRE-mediated gene transcription.. | |
| Protein Sequence | MREYKVVVLGSGGVGKSALTVQFVTGTFIEKYDPTIEDFYRKEIEVDSSPSVLEILDTAGTEQFASMRDLYIKNGQGFILVYSLVNQQSFQDIKPMRDQIVRVKRYEKVPLILVGNKVDLEPEREVMSSEGRALAQEWGCPFMETSAKSKSMVDELFAEIVRQMNYSSLPEKQDQCCTTCVVQ | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 27 | Phosphorylation | TVQFVTGTFIEKYDP EEEEEEECHHHHCCC | 16.45 | - | |
| 31 | Ubiquitination | VTGTFIEKYDPTIED EEECHHHHCCCCHHH | 50.57 | - | |
| 48 | Phosphorylation | RKEIEVDSSPSVLEI HCCCCCCCCHHHHHH | 49.69 | 20415495 | |
| 49 | Phosphorylation | KEIEVDSSPSVLEIL CCCCCCCCHHHHHHH | 19.41 | 20415495 | |
| 51 | Phosphorylation | IEVDSSPSVLEILDT CCCCCCHHHHHHHHC | 41.08 | 29899451 | |
| 61 | Phosphorylation | EILDTAGTEQFASMR HHHHCCCCHHHHHHH | 24.93 | 20415495 | |
| 66 | Phosphorylation | AGTEQFASMRDLYIK CCCHHHHHHHHEEEE | 18.68 | 19144319 | |
| 149 | Phosphorylation | FMETSAKSKSMVDEL CHHCCCCCHHHHHHH | 29.67 | 22817900 | |
| 151 | Phosphorylation | ETSAKSKSMVDELFA HCCCCCHHHHHHHHH | 31.00 | 22817900 | |
| 166 | Phosphorylation | EIVRQMNYSSLPEKQ HHHHHCCCCCCCHHH | 8.36 | 22817900 | |
| 167 | Phosphorylation | IVRQMNYSSLPEKQD HHHHCCCCCCCHHHC | 22.01 | - | |
| 176 | S-palmitoylation | LPEKQDQCCTTCVVQ CCHHHCCCCCEEEEC | 2.75 | 19061864 | |
| 177 | S-palmitoylation | PEKQDQCCTTCVVQ- CHHHCCCCCEEEEC- | 2.68 | 19061864 | |
| 180 | Methylation | QDQCCTTCVVQ---- HCCCCCEEEEC---- | 1.20 | 19061864 | |
| 180 | Geranylgeranylation | QDQCCTTCVVQ---- HCCCCCEEEEC---- | 1.20 | 19061864 | |
| 180 | Geranylgeranylation | QDQCCTTCVVQ---- HCCCCCEEEEC---- | 1.20 | 19061864 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RAP2C_MOUSE !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RAP2C_MOUSE !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RAP2C_MOUSE !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of RAP2C_MOUSE !! | ||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
| Phosphorylation | |
| Reference | PubMed |
| "The phagosomal proteome in interferon-gamma-activated macrophages."; Trost M., English L., Lemieux S., Courcelles M., Desjardins M.,Thibault P.; Immunity 30:143-154(2009). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-66, AND MASSSPECTROMETRY. | |