RAP2B_MOUSE - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: RAP2B_MOUSE
• UniProt AC: P61226
• Protein Name: Ras-related protein Rap-2b
• Gene Name: Rap2b
• Organism: Mus musculus (Mouse).
• Sequence Length: 183
• Subcellular Localization: Recycling endosome membrane ; Lipid-anchor ; Cytoplasmic side . Associated with red blood cells-released vesicles..
• Protein Description: Small GTP-binding protein which cycles between a GDP-bound inactive and a GTP-bound active form. Involved in EGFR and CHRM3 signaling pathways through stimulation of PLCE1. May play a role in cytoskeletal rearrangements and regulate cell spreading through activation of the effector TNIK. May regulate membrane vesiculation in red blood cells..
• Protein Sequence: MREYKVVVLGSGGVGKSALTVQFVTGSFIEKYDPTIEDFYRKEIEVDSSPSVLEILDTAGTEQFASMRDLYIKNGQGFILVYSLVNQQSFQDIKPMRDQIIRVKRYERVPMILVGNKVDLEGEREVSYGEGKALAEEWSCPFMETSAKNKASVDELFAEIVRQMNYAAQPNGDEGCCSACVIL

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
27	Phosphorylation	TVQFVTGSFIEKYDP EEEEEECCHHHHCCC	17.43	22817900
48	Phosphorylation	RKEIEVDSSPSVLEI HCCCCCCCCHHHHHH	49.69	20415495
49	Phosphorylation	KEIEVDSSPSVLEIL CCCCCCCCHHHHHHH	19.41	20415495
51	Phosphorylation	IEVDSSPSVLEILDT CCCCCCHHHHHHHHC	41.08	29899451
61	Phosphorylation	EILDTAGTEQFASMR HHHHCCCCHHHHHHH	24.93	20415495
66	Phosphorylation	AGTEQFASMRDLYIK CCCHHHHHHHHEEEE	18.68	19144319
152	Phosphorylation	TSAKNKASVDELFAE CCCCCCCCHHHHHHH	31.54	22817900
176	S-palmitoylation	QPNGDEGCCSACVIL CCCCCCCCCCEEEEC	1.23	19061864
177	S-palmitoylation	PNGDEGCCSACVIL- CCCCCCCCCEEEEC-	4.20	19061864
180	Methylation	DEGCCSACVIL---- CCCCCCEEEEC----	0.82	19061864
180	Geranylgeranylation	DEGCCSACVIL---- CCCCCCEEEEC----	0.82	19061864
180	Geranylgeranylation	DEGCCSACVIL---- CCCCCCEEEEC----	0.82	19061864

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of RAP2B_MOUSE !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of RAP2B_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of RAP2B_MOUSE !!

Protein-Protein Interaction

Oops, there are no PPI records of RAP2B_MOUSE !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.