RAP2A_MOUSE - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: RAP2A_MOUSE
• UniProt AC: Q80ZJ1
• Protein Name: Ras-related protein Rap-2a
• Gene Name: Rap2a
• Organism: Mus musculus (Mouse).
• Sequence Length: 183
• Subcellular Localization: Midbody. Recycling endosome membrane ; Lipid-anchor ; Cytoplasmic side . Localizes to midbody at telophase. May also localize to the Golgi and the gelatinase-containing granules of neutrophils..
• Protein Description: Small GTP-binding protein which cycles between a GDP-bound inactive and a GTP-bound active form. In its active form interacts with and regulates several effectors including MAP4K4, MINK1 and TNIK. Part of a signaling complex composed of NEDD4, RAP2A and TNIK which regulates neuronal dendrite extension and arborization during development. More generally, it is part of several signaling cascades and may regulate cytoskeletal rearrangements, cell migration, cell adhesion and cell spreading..
• Protein Sequence: MREYKVVVLGSGGVGKSALTVQFVTGTFIEKYDPTIEDFYRKEIEVDSSPSVLEILDTAGTEQFASMRDLYIKNGQGFILVYSLVNQQSFQDIKPMRDQIIRVKRYEKVPVILVGNKVDLESEREVSSNEGRALAEEWGCPFMETSAKSKTMVDELFAEIVRQMNYAAQPDKDDPCCSACNIQ

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
27	Phosphorylation	TVQFVTGTFIEKYDP EEEEEEECHHHHCCC	16.45	-
31	Ubiquitination	VTGTFIEKYDPTIED EEECHHHHCCCCHHH	50.57	-
48	Phosphorylation	RKEIEVDSSPSVLEI HCCCCCCCCHHHHHH	49.69	20415495
49	Phosphorylation	KEIEVDSSPSVLEIL CCCCCCCCHHHHHHH	19.41	20415495
51	Phosphorylation	IEVDSSPSVLEILDT CCCCCCHHHHHHHHC	41.08	29899451
61	Phosphorylation	EILDTAGTEQFASMR HHHHCCCCHHHHHHH	24.93	20415495
66	Phosphorylation	AGTEQFASMRDLYIK CCCHHHHHHHHEEEE	18.68	19144319
108	Ubiquitination	IRVKRYEKVPVILVG EEEEECCCCCEEEEC	42.79	22790023
127	Phosphorylation	LESEREVSSNEGRAL CCCHHCCCCHHHHHH	23.77	24759943
149	Phosphorylation	FMETSAKSKTMVDEL CHHCCCCCCHHHHHH	32.83	29899451
151	Phosphorylation	ETSAKSKTMVDELFA HCCCCCCHHHHHHHH	29.53	19060867
176	S-palmitoylation	QPDKDDPCCSACNIQ CCCCCCCCCCCCCCC	3.54	19061864
177	S-palmitoylation	PDKDDPCCSACNIQ- CCCCCCCCCCCCCC-	3.34	19061864
180	Methylation	DDPCCSACNIQ---- CCCCCCCCCCC----	2.37	19061864
180	Farnesylation	DDPCCSACNIQ---- CCCCCCCCCCC----	2.37	19061864
180	Farnesylation	DDPCCSACNIQ---- CCCCCCCCCCC----	2.37	19061864

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of RAP2A_MOUSE !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
63	K	ubiquitylation	Ubiquitinated; undergoes 'Lys-63' monoubiquitination and diubiquitination by NEDD4.	20159449

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of RAP2A_MOUSE !!

Protein-Protein Interaction

Oops, there are no PPI records of RAP2A_MOUSE !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.