UniProt ID | RANT_MOUSE | |
---|---|---|
UniProt AC | Q61820 | |
Protein Name | GTP-binding nuclear protein Ran, testis-specific isoform | |
Gene Name | Rasl2-9 | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 216 | |
Subcellular Localization | Nucleus. | |
Protein Description | GTP-binding protein involved in nucleocytoplasmic transport. Required for the import of protein into the nucleus and also for RNA export. Involved in chromatin condensation and control of cell cycle (By similarity).. | |
Protein Sequence | MAAQGEPQVQFKVVLVGDGGTGKTTFMKRHLTGEFEKEYVATLGVEVHTLVFHTNRGPIKFNVWDTAGQEKFGGLRDGYYIQAQCAIIMFDVTSRVTYKNVPSWHKDLVRVCENIPIVLCGNKVDVKDMKVKAKPILFHRKKNLQYYDISARSNYNFEKPFFWLARKLIGDPNLEFVAMPALAPPEVVMDPALAAQYEHDLEVAQTTALPDEEDDL | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Acetylation | ------MAAQGEPQV ------CCCCCCCEE | 14.43 | - | |
21 | Phosphorylation | VLVGDGGTGKTTFMK EEECCCCCCCCCEEC | 40.82 | - | |
24 | Phosphorylation | GDGGTGKTTFMKRHL CCCCCCCCCEECCCC | 26.98 | 24719451 | |
32 | Phosphorylation | TFMKRHLTGEFEKEY CEECCCCCCCCCCEE | 28.65 | 24899341 | |
60 | Acetylation | HTNRGPIKFNVWDTA ECCCCCEEEEEEECC | 33.74 | 66739521 | |
60 | Ubiquitination | HTNRGPIKFNVWDTA ECCCCCEEEEEEECC | 33.74 | - | |
71 | Acetylation | WDTAGQEKFGGLRDG EECCCCCCCCCCCCC | 41.23 | - | |
71 | Ubiquitination | WDTAGQEKFGGLRDG EECCCCCCCCCCCCC | 41.23 | - | |
99 | Acetylation | VTSRVTYKNVPSWHK CCCCCEECCCCHHHH | 41.94 | - | |
112 | Glutathionylation | HKDLVRVCENIPIVL HHHHHHHHCCCCEEE | 2.02 | 24333276 | |
120 | Glutathionylation | ENIPIVLCGNKVDVK CCCCEEEECCCCCHH | 3.80 | 24333276 | |
134 | Acetylation | KDMKVKAKPILFHRK HHCCEECEEEEEEEC | 27.20 | - | |
159 | Acetylation | RSNYNFEKPFFWLAR CCCCCCCCHHHHHHH | 42.88 | - | |
159 | Succinylation | RSNYNFEKPFFWLAR CCCCCCCCHHHHHHH | 42.88 | - | |
159 | Succinylation | RSNYNFEKPFFWLAR CCCCCCCCHHHHHHH | 42.88 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RANT_MOUSE !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RANT_MOUSE !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RANT_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of RANT_MOUSE !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...