| UniProt ID | RALB_RAT | |
|---|---|---|
| UniProt AC | P36860 | |
| Protein Name | Ras-related protein Ral-B | |
| Gene Name | Ralb | |
| Organism | Rattus norvegicus (Rat). | |
| Sequence Length | 206 | |
| Subcellular Localization |
Cell membrane Lipid-anchor Cytoplasmic side . Midbody . During late cytokinesis, enriched at the midbody. |
|
| Protein Description | Multifunctional GTPase involved in a variety of cellular processes including gene expression, cell migration, cell proliferation, oncogenic transformation and membrane trafficking. Accomplishes its multiple functions by interacting with distinct downstream effectors. Acts as a GTP sensor for GTP-dependent exocytosis of dense core vesicles. [PubMed: 17202486 Required both to stabilize the assembly of the exocyst complex and to localize functional exocyst complexes to the leading edge of migrating cells] | |
| Protein Sequence | MAANKGKSQGSLVLHKVIMVGSGGVGKSALTLQFMYDEFVEDYEPTKADSYRKKVVLDGEEVQIDILDTAGQEDYAAIRDNYFRSGEGFLLVFSITEHESFTATAEFREQILRVKAEEDKIPLLVVGNKSDLEERRQVPVEEARGKAEEWGVQYVETSAKTRANVDKVFFDLMREIRAKKMSENKDKNGRKSGKSKKSFKERCCLL | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 11 | Phosphorylation | NKGKSQGSLVLHKVI CCCCCCCCEEEEEEE | 13.99 | 23984901 | |
| 75 | Phosphorylation | DTAGQEDYAAIRDNY CCCCCCCHHHHHHCC | 9.36 | 21940666 | |
| 160 | Ubiquitination | QYVETSAKTRANVDK EEEECCCCCCCCHHH | 38.01 | - | |
| 167 | Acetylation | KTRANVDKVFFDLMR CCCCCHHHHHHHHHH | 36.34 | 22902405 | |
| 203 | Methylation | KKSFKERCCLL---- HHHHHHHHCCC---- | 1.69 | - | |
| 203 | Geranylgeranylation | KKSFKERCCLL---- HHHHHHHHCCC---- | 1.69 | - |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RALB_RAT !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RALB_RAT !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RALB_RAT !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of RALB_RAT !! | ||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
