RALB_MOUSE - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: RALB_MOUSE
• UniProt AC: Q9JIW9
• Protein Name: Ras-related protein Ral-B
• Gene Name: Ralb
• Organism: Mus musculus (Mouse).
• Sequence Length: 206
• Subcellular Localization: Cell membrane ; Lipid-anchor ; Cytoplasmic side . Midbody . During late cytokinesis, enriched at the midbody.
• Protein Description: Multifunctional GTPase involved in a variety of cellular processes including gene expression, cell migration, cell proliferation, oncogenic transformation and membrane trafficking. Accomplishes its multiple functions by interacting with distinct downstream effectors. Acts as a GTP sensor for GTP-dependent exocytosis of dense core vesicles (By similarity). Required both to stabilize the assembly of the exocyst complex and to localize functional exocyst complexes to the leading edge of migrating cells (By similarity). Required for suppression of apoptosis (By similarity). In late stages of cytokinesis, upon completion of the bridge formation between dividing cells, mediates exocyst recruitment to the midbody to drive abscission (By similarity)..
• Protein Sequence: MAANKGKSQGSLVLHKVIMVGSGGVGKSALTLQFMYDEFVEDYEPTKADSYRKKVVLDGEEVQIDILDTAGQEDYAAIRDNYFRSGEGFLLVFSITEHESFTATAEFREQILRVKSEEDKIPLLVVGNKSDLEERRQVPVDEARGKAEEWGVQYVETSAKTRANVDKVFFDLMREIRAKKMSENKDKNGRKSSKSKKSFKERCCLL

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
8	Phosphorylation	MAANKGKSQGSLVLH CCCCCCCCCCCEEEE	48.74	29472430
11	Phosphorylation	NKGKSQGSLVLHKVI CCCCCCCCEEEEEEE	13.99	26060331
50	Phosphorylation	YEPTKADSYRKKVVL CCCCCCHHCCCEEEE	31.53	29899451
75	Phosphorylation	DTAGQEDYAAIRDNY CCCCCCCHHHHHHCC	9.36	25159016
160	Ubiquitination	QYVETSAKTRANVDK EEEECCCCCCCCHHH	38.01	-
203	Methylation	KKSFKERCCLL---- HHHHHHHHCCC----	1.69	-
203	Geranylgeranylation	KKSFKERCCLL---- HHHHHHHHCCC----	1.69	-
204	S-palmitoylation	KSFKERCCLL----- HHHHHHHCCC-----	5.63	23358418

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of RALB_MOUSE !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of RALB_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of RALB_MOUSE !!

Protein-Protein Interaction

Oops, there are no PPI records of RALB_MOUSE !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.