RALA_MOUSE - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: RALA_MOUSE
• UniProt AC: P63321
• Protein Name: Ras-related protein Ral-A
• Gene Name: Rala
• Organism: Mus musculus (Mouse).
• Sequence Length: 206
• Subcellular Localization: Cell membrane ; Lipid-anchor ; Cytoplasmic side. Cleavage furrow . Midbody, Midbody ring . Predominantly at the cell surface in the absence of LPA. In the presence of LPA, colocalizes with LPAR1 and LPAR2 in endocytic vesicles.
• Protein Description: Multifunctional GTPase involved in a variety of cellular processes including gene expression, cell migration, cell proliferation, oncogenic transformation and membrane trafficking. Accomplishes its multiple functions by interacting with distinct downstream effectors. Acts as a GTP sensor for GTP-dependent exocytosis of dense core vesicles. Key regulator of LPAR1 signaling and competes with GRK2 for binding to LPAR1 thus affecting the signaling properties of the receptor. Required for anchorage-independent proliferation of transformed cells (By similarity). The RALA-exocyst complex regulates integrin-dependent membrane raft exocytosis and growth signaling. [PubMed: 20005108 During mitosis, supports the stabilization and elongation of the intracellular bridge between dividing cells. Cooperates with EXOC2 to recruit other components of the exocyst to the early midbody (By similarity]
• Protein Sequence: MAANKPKGQNSLALHKVIMVGSGGVGKSALTLQFMYDEFVEDYEPTKADSYRKKVVLDGEEVQIDILDTAGQEDYAAIRDNYFRSGEGFLCVFSITEMESFAATADFREQILRVKEDENVPFLLVGNKSDLEDKRQVSVEEAKNRADQWNVNYVETSAKTRANVDKVFFDLMREIRARKMEDSKEKNGKKKRKSLAKRIRERCCIL

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
7	Ubiquitination	-MAANKPKGQNSLAL -CCCCCCCCCCCCCC	74.80	-
11	Phosphorylation	NKPKGQNSLALHKVI CCCCCCCCCCCEEEE	13.71	22817900
50	Phosphorylation	YEPTKADSYRKKVVL CCCCCCHHCCCEEEE	31.53	29899451
75	Phosphorylation	DTAGQEDYAAIRDNY CCCCCCCHHHHHHCC	9.36	25159016
134	Ubiquitination	NKSDLEDKRQVSVEE CHHHHCCHHCCCHHH	35.04	27667366
138	O-linked_Glycosylation	LEDKRQVSVEEAKNR HCCHHCCCHHHHHHH	18.57	30059200
138	Phosphorylation	LEDKRQVSVEEAKNR HCCHHCCCHHHHHHH	18.57	29899451
143	Ubiquitination	QVSVEEAKNRADQWN CCCHHHHHHHHHHCC	50.69	27667366
159	Ubiquitination	NYVETSAKTRANVDK CEEECCHHHCCCHHH	38.01	27667366
184	Acetylation	ARKMEDSKEKNGKKK HHHHHHHHHHHCHHH	82.25	30987113
189	Acetylation	DSKEKNGKKKRKSLA HHHHHHCHHHHHHHH	65.60	30987119
203	Methylation	AKRIRERCCIL---- HHHHHHHHCCC----	1.13	-
203	Geranylgeranylation	AKRIRERCCIL---- HHHHHHHHCCC----	1.13	-
204	S-palmitoylation	KRIRERCCIL----- HHHHHHHCCC-----	4.44	23358418

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of RALA_MOUSE !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of RALA_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of RALA_MOUSE !!

Protein-Protein Interaction

Oops, there are no PPI records of RALA_MOUSE !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.