RAG3D_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: RAG3D_ARATH
• UniProt AC: Q9C820
• Protein Name: Ras-related protein RABG3d
• Gene Name: RABG3D
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 206
• Subcellular Localization: Cell membrane ; Lipid-anchor ; Cytoplasmic side .
• Protein Description: Intracellular vesicle trafficking and protein transport..
• Protein Sequence: MSSRRRVLLKVIILGDSGVGKTSLMNQFVNRKFSNQYKATIGADFLTKEVQIDDRIFTLQIWDTAGQERFQSLGVAFYRGADCCVLVYDVNVMKSFDNLNNWREEFLIQASPSDPENFPFVVLGNKTDVDGGKSRVVSEKKAKAWCASKGNIPYFETSAKEGFNVDAAFECITKNAFKNEPEEEPYLPDTIDVAGGQQQRSTGCEC

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
22	Phosphorylation	GDSGVGKTSLMNQFV CCCCCCHHHHHHHHH	22.59	19880383
23	Phosphorylation	DSGVGKTSLMNQFVN CCCCCHHHHHHHHHH	29.16	19880383
204	Geranylgeranylation	QQQRSTGCEC----- CCCCCCCCCC-----	4.97	-
206	Geranylgeranylation	QRSTGCEC------- CCCCCCCC-------	8.64	-
206	Methylation	QRSTGCEC------- CCCCCCCC-------	8.64	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of RAG3D_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of RAG3D_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of RAG3D_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
NAC89_ARATH	NAC089	physical	21798944
NIP11_ARATH	NLM1	physical	21798944

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.