UniProt ID | RAE1L_MOUSE | |
---|---|---|
UniProt AC | Q8C570 | |
Protein Name | mRNA export factor | |
Gene Name | Rae1 | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 368 | |
Subcellular Localization | Cytoplasm . Nucleus . Cytoplasm, cytoskeleton, spindle pole . Recruited from interphase nuclei to spindle MTs during mitosis. | |
Protein Description | Plays a role in mitotic bipolar spindle formation. Binds mRNA. May function in nucleocytoplasmic transport and in directly or indirectly attaching cytoplasmic mRNPs to the cytoskeleton.. | |
Protein Sequence | MSLFGSTSGFGTGGTSMFGSTTTDNHNPMKDIEVTSSPDDSIGCLSFSPPTLPGNFLIAGSWANDVRCWEVQDSGQTIPKAQQMHTGPVLDVCWSDDGSKVFTASCDKTAKMWDLNSNQAIQIAQHDAPVKTIHWIKAPNYSCVMTGSWDKTLKFWDTRSSNPMMVLQLPERCYCADVIYPMAVVATAERGLIVYQLENQPSEFRRIESPLKHQHRCVAIFKDKQNKPTGFALGSIEGRVAIHYINPPNPAKDNFTFKCHRSNGTNTSAPQDIYAVNGIAFHPVHGTLATVGSDGRFSFWDKDARTKLKTSEQLDQPIAACCFNHNGNIFAYASSYDWSKGHEFYNPQKKNYIFLRNAAEELKPRNKK | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
106 | Glutathionylation | SKVFTASCDKTAKMW CEEEEEECCCCCCEE | 6.04 | 24333276 | |
209 | Phosphorylation | SEFRRIESPLKHQHR HHHHCCCCCCCCCCE | 32.91 | 24719451 | |
229 | Phosphorylation | KDKQNKPTGFALGSI ECCCCCCCCEEEEEE | 46.68 | - | |
252 | Ubiquitination | INPPNPAKDNFTFKC ECCCCCCCCCEEEEE | 55.23 | - | |
274 | Phosphorylation | TSAPQDIYAVNGIAF CCCCCEEEEECCEEE | 16.88 | 22817900 | |
345 | Phosphorylation | WSKGHEFYNPQKKNY CCCCCCCCCCCCCCE | 23.97 | 29514104 | |
352 | Phosphorylation | YNPQKKNYIFLRNAA CCCCCCCEEEECCHH | 11.26 | 29514104 | |
363 | Ubiquitination | RNAAEELKPRNKK-- CCHHHHHCCCCCC-- | 45.25 | 27667366 | |
363 | Acetylation | RNAAEELKPRNKK-- CCHHHHHCCCCCC-- | 45.25 | 23806337 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RAE1L_MOUSE !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RAE1L_MOUSE !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RAE1L_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of RAE1L_MOUSE !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...