| UniProt ID | RAE1L_MOUSE | |
|---|---|---|
| UniProt AC | Q8C570 | |
| Protein Name | mRNA export factor | |
| Gene Name | Rae1 | |
| Organism | Mus musculus (Mouse). | |
| Sequence Length | 368 | |
| Subcellular Localization | Cytoplasm . Nucleus . Cytoplasm, cytoskeleton, spindle pole . Recruited from interphase nuclei to spindle MTs during mitosis. | |
| Protein Description | Plays a role in mitotic bipolar spindle formation. Binds mRNA. May function in nucleocytoplasmic transport and in directly or indirectly attaching cytoplasmic mRNPs to the cytoskeleton.. | |
| Protein Sequence | MSLFGSTSGFGTGGTSMFGSTTTDNHNPMKDIEVTSSPDDSIGCLSFSPPTLPGNFLIAGSWANDVRCWEVQDSGQTIPKAQQMHTGPVLDVCWSDDGSKVFTASCDKTAKMWDLNSNQAIQIAQHDAPVKTIHWIKAPNYSCVMTGSWDKTLKFWDTRSSNPMMVLQLPERCYCADVIYPMAVVATAERGLIVYQLENQPSEFRRIESPLKHQHRCVAIFKDKQNKPTGFALGSIEGRVAIHYINPPNPAKDNFTFKCHRSNGTNTSAPQDIYAVNGIAFHPVHGTLATVGSDGRFSFWDKDARTKLKTSEQLDQPIAACCFNHNGNIFAYASSYDWSKGHEFYNPQKKNYIFLRNAAEELKPRNKK | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 106 | Glutathionylation | SKVFTASCDKTAKMW CEEEEEECCCCCCEE | 6.04 | 24333276 | |
| 209 | Phosphorylation | SEFRRIESPLKHQHR HHHHCCCCCCCCCCE | 32.91 | 24719451 | |
| 229 | Phosphorylation | KDKQNKPTGFALGSI ECCCCCCCCEEEEEE | 46.68 | - | |
| 252 | Ubiquitination | INPPNPAKDNFTFKC ECCCCCCCCCEEEEE | 55.23 | - | |
| 274 | Phosphorylation | TSAPQDIYAVNGIAF CCCCCEEEEECCEEE | 16.88 | 22817900 | |
| 345 | Phosphorylation | WSKGHEFYNPQKKNY CCCCCCCCCCCCCCE | 23.97 | 29514104 | |
| 352 | Phosphorylation | YNPQKKNYIFLRNAA CCCCCCCEEEECCHH | 11.26 | 29514104 | |
| 363 | Ubiquitination | RNAAEELKPRNKK-- CCHHHHHCCCCCC-- | 45.25 | 27667366 | |
| 363 | Acetylation | RNAAEELKPRNKK-- CCHHHHHCCCCCC-- | 45.25 | 23806337 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RAE1L_MOUSE !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RAE1L_MOUSE !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RAE1L_MOUSE !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of RAE1L_MOUSE !! | ||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...