RAD2A_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: RAD2A_ARATH
• UniProt AC: P28188
• Protein Name: Ras-related protein RABD2a
• Gene Name: RABD2A
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 203
• Subcellular Localization: Golgi apparatus, trans-Golgi network membrane . Golgi apparatus membrane ; Lipid-anchor .
• Protein Description: Protein transport. Regulator of membrane traffic from the Golgi apparatus towards the endoplasmic reticulum (ER)..
• Protein Sequence: MNPEYDYLFKLLLIGDSGVGKSCLLLRFSDDSYVESYISTIGVDFKIRTVEQDGKTIKLQIWDTAGQERFRTITSSYYRGAHGIIIVYDVTDEESFNNVKQWLSEIDRYASDNVNKLLVGNKSDLTENRAIPYETAKAFADEIGIPFMETSAKDATNVEQAFMAMSASIKERMASQPAGNNARPPTVQIRGQPVAQKNGCCST

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
74	Phosphorylation	QERFRTITSSYYRGA HHHHHHHHHHHHCCC	15.82	25561503
75	Phosphorylation	ERFRTITSSYYRGAH HHHHHHHHHHHCCCC	16.70	29654922
200	Geranylgeranylation	PVAQKNGCCST---- ECCCCCCCCCC----	2.01	-
201	Geranylgeranylation	VAQKNGCCST----- CCCCCCCCCC-----	5.51	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of RAD2A_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of RAD2A_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of RAD2A_ARATH !!

Protein-Protein Interaction

Oops, there are no PPI records of RAD2A_ARATH !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.