UniProt ID | RAD2A_ARATH | |
---|---|---|
UniProt AC | P28188 | |
Protein Name | Ras-related protein RABD2a | |
Gene Name | RABD2A | |
Organism | Arabidopsis thaliana (Mouse-ear cress). | |
Sequence Length | 203 | |
Subcellular Localization |
Golgi apparatus, trans-Golgi network membrane . Golgi apparatus membrane Lipid-anchor . |
|
Protein Description | Protein transport. Regulator of membrane traffic from the Golgi apparatus towards the endoplasmic reticulum (ER).. | |
Protein Sequence | MNPEYDYLFKLLLIGDSGVGKSCLLLRFSDDSYVESYISTIGVDFKIRTVEQDGKTIKLQIWDTAGQERFRTITSSYYRGAHGIIIVYDVTDEESFNNVKQWLSEIDRYASDNVNKLLVGNKSDLTENRAIPYETAKAFADEIGIPFMETSAKDATNVEQAFMAMSASIKERMASQPAGNNARPPTVQIRGQPVAQKNGCCST | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
74 | Phosphorylation | QERFRTITSSYYRGA HHHHHHHHHHHHCCC | 15.82 | 25561503 | |
75 | Phosphorylation | ERFRTITSSYYRGAH HHHHHHHHHHHCCCC | 16.70 | 29654922 | |
200 | Geranylgeranylation | PVAQKNGCCST---- ECCCCCCCCCC---- | 2.01 | - | |
201 | Geranylgeranylation | VAQKNGCCST----- CCCCCCCCCC----- | 5.51 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RAD2A_ARATH !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RAD2A_ARATH !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RAD2A_ARATH !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of RAD2A_ARATH !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...