| UniProt ID | RAC2_MOUSE | |
|---|---|---|
| UniProt AC | Q05144 | |
| Protein Name | Ras-related C3 botulinum toxin substrate 2 | |
| Gene Name | Rac2 | |
| Organism | Mus musculus (Mouse). | |
| Sequence Length | 192 | |
| Subcellular Localization |
Cytoplasm. Membrane Lipid-anchor. Membrane-associated when activated.. |
|
| Protein Description | Plasma membrane-associated small GTPase which cycles between an active GTP-bound and inactive GDP-bound state. In active state binds to a variety of effector proteins to regulate cellular responses, such as secretory processes, phagocytose of apoptotic cells and epithelial cell polarization. Augments the production of reactive oxygen species (ROS) by NADPH oxidase.. | |
| Protein Sequence | MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDSKPVNLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVSPASYENVRAKWFPEVRHHCPSTPIILVGTKLDLRDDKDTIEKLKEKKLAPITYPQGLALAKDIDSVKYLECSALTQRGLKTVFDEAIRAVLCPQPTRQQKRPCSLL | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 17 | Phosphorylation | GDGAVGKTCLLISYT CCCCCCCEEEEEEEE | 11.49 | - | |
| 22 | Phosphorylation | GKTCLLISYTTNAFP CCEEEEEEEECCCCC | 19.18 | - | |
| 23 | Phosphorylation | KTCLLISYTTNAFPG CEEEEEEEECCCCCC | 15.58 | - | |
| 24 | Phosphorylation | TCLLISYTTNAFPGE EEEEEEEECCCCCCC | 13.54 | - | |
| 64 | Phosphorylation | DTAGQEDYDRLRPLS CCCCCCCHHHCCCCC | 11.38 | - | |
| 105 | Glutathionylation | FPEVRHHCPSTPIIL CHHHHHHCCCCCEEE | 2.02 | 24333276 | |
| 107 | Phosphorylation | EVRHHCPSTPIILVG HHHHHCCCCCEEEEE | 52.81 | 24719451 | |
| 116 | Ubiquitination | PIILVGTKLDLRDDK CEEEEEECCCCCCCH | 33.79 | - | |
| 123 | Ubiquitination | KLDLRDDKDTIEKLK CCCCCCCHHHHHHHH | 62.15 | 22790023 | |
| 125 | Phosphorylation | DLRDDKDTIEKLKEK CCCCCHHHHHHHHHC | 36.45 | 29899451 | |
| 128 | Ubiquitination | DDKDTIEKLKEKKLA CCHHHHHHHHHCCCC | 62.09 | 22790023 | |
| 147 | Ubiquitination | PQGLALAKDIDSVKY HHHHHHHCCCCCCCE | 56.94 | 27667366 | |
| 147 | Acetylation | PQGLALAKDIDSVKY HHHHHHHCCCCCCCE | 56.94 | - | |
| 153 | Ubiquitination | AKDIDSVKYLECSAL HCCCCCCCEEEHHHH | 48.33 | - | |
| 157 | S-nitrosylation | DSVKYLECSALTQRG CCCCEEEHHHHHHHH | 2.38 | 22588120 | |
| 157 | Glutathionylation | DSVKYLECSALTQRG CCCCEEEHHHHHHHH | 2.38 | 24333276 | |
| 157 | S-palmitoylation | DSVKYLECSALTQRG CCCCEEEHHHHHHHH | 2.38 | 28526873 | |
| 158 | Phosphorylation | SVKYLECSALTQRGL CCCEEEHHHHHHHHH | 19.55 | 20531401 | |
| 161 | Phosphorylation | YLECSALTQRGLKTV EEEHHHHHHHHHHHH | 18.88 | 22817900 | |
| 166 | Ubiquitination | ALTQRGLKTVFDEAI HHHHHHHHHHHHHHH | 45.53 | 27667366 | |
| 167 | Phosphorylation | LTQRGLKTVFDEAIR HHHHHHHHHHHHHHH | 31.29 | 25177544 | |
| 178 | Glutathionylation | EAIRAVLCPQPTRQQ HHHHHHHCCCCCCCC | 2.06 | 24333276 | |
| 189 | Geranylgeranylation | TRQQKRPCSLL---- CCCCCCCCCCC---- | 5.34 | - | |
| 189 | Methylation | TRQQKRPCSLL---- CCCCCCCCCCC---- | 5.34 | - |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RAC2_MOUSE !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RAC2_MOUSE !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RAC2_MOUSE !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of RAC2_MOUSE !! | ||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...