UniProt ID | RABX5_BOVIN | |
---|---|---|
UniProt AC | O18973 | |
Protein Name | Rab5 GDP/GTP exchange factor | |
Gene Name | RABGEF1 | |
Organism | Bos taurus (Bovine). | |
Sequence Length | 492 | |
Subcellular Localization | Cytoplasm . Early endosome . Recycling endosome . | |
Protein Description | Rab effector protein acting as linker between gamma-adaptin and RAB5A. Involved in endocytic membrane fusion and membrane trafficking of recycling endosomes. Stimulates nucleotide exchange on RAB5A. Can act as a ubiquitin ligase.. | |
Protein Sequence | MSLKSERRGIHVDQSELLCKKGCGYYGNPAWQGFCSKCWREEYHKARQKQIQEDWELAERLQREEEEAFASSQSSQGAQSLTFSKFEEKKTNEKTRKVTTVKKFFSASSRVGAKKAEIQEAKAPSPSINRQTSIETDRVSKEFIEFLKTFHKTGQEIYKQTKLFLEAMHYKRDLSIEEQSECTQDFYQNVAERMQTRGKVPPERVEKIMDQIEKYIMTRLYKYVFCPETTDDEKKDLAIQKRIRALHWVTPQMLCVPVNEEIPEVSDMVVKAITDIIEMDSKRVPRDKLACITKCSKHIFNAIKITKNEPASADDFLPTLIYIVLKGNPPRLQSNIQYITRFCNPSRLMTGEDGYYFTNLCCAVAFIEKLDAQSLNLSQEDFDRYMSGQTSPRKQESENWSPDACLGVKQMYKNLDLLSQLNERQERIMNEAKKLEKDLIDWTDGIAKEVQDIVEKYPLEIRPPNQSVAAIDSENVENDKLPPPLQPQVYAG | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
125 | Phosphorylation | IQEAKAPSPSINRQT HHCCCCCCCCCCCCC | 35.82 | - | |
133 | Phosphorylation | PSINRQTSIETDRVS CCCCCCCCCCHHHHH | 15.30 | - | |
152 | Acetylation | EFLKTFHKTGQEIYK HHHHHHHHHHHHHHH | 50.59 | - | |
171 | Acetylation | FLEAMHYKRDLSIEE HHHHHHHCCCCCHHH | 25.43 | - | |
374 | Phosphorylation | IEKLDAQSLNLSQED HHHHCHHHCCCCHHH | 22.42 | - | |
378 | Phosphorylation | DAQSLNLSQEDFDRY CHHHCCCCHHHHHHH | 30.37 | - | |
391 | Phosphorylation | RYMSGQTSPRKQESE HHHCCCCCCCCCCCC | 18.15 | - | |
401 | Phosphorylation | KQESENWSPDACLGV CCCCCCCCHHHHHHH | 25.20 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RABX5_BOVIN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RABX5_BOVIN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RABX5_BOVIN !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...