UniProt ID | RABP1_HUMAN | |
---|---|---|
UniProt AC | P29762 | |
Protein Name | Cellular retinoic acid-binding protein 1 | |
Gene Name | CRABP1 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 137 | |
Subcellular Localization | Cytoplasm . | |
Protein Description | Cytosolic CRABPs may regulate the access of retinoic acid to the nuclear retinoic acid receptors.. | |
Protein Sequence | MPNFAGTWKMRSSENFDELLKALGVNAMLRKVAVAAASKPHVEIRQDGDQFYIKTSTTVRTTEINFKVGEGFEEETVDGRKCRSLATWENENKIHCTQTLLEGDGPKTYWTRELANDELILTFGADDVVCTRIYVRE | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
12 | Phosphorylation | AGTWKMRSSENFDEL CCCCCCCCCCCHHHH | 38.21 | 21406692 | |
13 | Phosphorylation | GTWKMRSSENFDELL CCCCCCCCCCHHHHH | 26.62 | 21406692 | |
21 | Ubiquitination | ENFDELLKALGVNAM CCHHHHHHHHCHHHH | 54.94 | - | |
31 | Ubiquitination | GVNAMLRKVAVAAAS CHHHHHHHHHHHHHC | 30.50 | - | |
38 | Phosphorylation | KVAVAAASKPHVEIR HHHHHHHCCCCEEEE | 41.83 | 17192257 | |
62 | Phosphorylation | TSTTVRTTEINFKVG ECCEEEEEEEEEEEC | 25.05 | 27251275 | |
97 | Phosphorylation | NENKIHCTQTLLEGD CCCCEEEEEEEECCC | 15.49 | 27251275 | |
99 | Phosphorylation | NKIHCTQTLLEGDGP CCEEEEEEEECCCCC | 18.37 | 27251275 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RABP1_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RABP1_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RABP1_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
TRA2A_HUMAN | TRA2A | physical | 21900206 |
loading...
Phosphorylation | |
Reference | PubMed |
"Kinase-selective enrichment enables quantitative phosphoproteomics ofthe kinome across the cell cycle."; Daub H., Olsen J.V., Bairlein M., Gnad F., Oppermann F.S., Korner R.,Greff Z., Keri G., Stemmann O., Mann M.; Mol. Cell 31:438-448(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-38, AND MASSSPECTROMETRY. |