dbPTM

RABA3_ARATH - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	RABA3_ARATH
UniProt AC	Q9LNK1
Protein Name	Ras-related protein RABA3
Gene Name	RABA3
Organism	Arabidopsis thaliana (Mouse-ear cress).
Sequence Length	237
Subcellular Localization	Endosome membrane . Golgi apparatus, trans-Golgi network membrane Lipid-anchor . During cytokinesis located to the growing margins of the cell plate.
Protein Description	Intracellular vesicle trafficking and protein transport..
Protein Sequence	MNEEMSGESPENNKHVKKPTMPEKIDYVFKVVVIGDSAVGKTQLLSRFTHNEFCYDSKSTIGVEFQTRTITLRGKLVKAQIWDTAGQERYRAVTSAYYRGALGAMVVYDITKRLSFDHVARWVEELRAHADDSAVIMLVGNKADLSVGKRAVPTEDAVEFAETQRLFFSEVSALSGGNVDEAFFRLLEEIFSRVVVSRKAMESDGGATVKLDGSRIDVISGSDLETSNIKEQASCSC

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
9	Phosphorylation	NEEMSGESPENNKHV CCCCCCCCCCCCCCC	40.83	25561503
69	Phosphorylation	GVEFQTRTITLRGKL EEEEEEEEEEECCEE	23.00	22074104
71	Phosphorylation	EFQTRTITLRGKLVK EEEEEEEEECCEEEE	15.13	22074104
115	Phosphorylation	YDITKRLSFDHVARW HHHHHCCCHHHHHHH	32.44	19880383
235	Geranylgeranylation	NIKEQASCSC----- CHHHHHCCCC-----	5.58	-
237	Geranylgeranylation	KEQASCSC------- HHHHCCCC-------	8.30	-
237	Methylation	KEQASCSC------- HHHHCCCC-------	8.30	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of RABA3_ARATH !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of RABA3_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of RABA3_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
PR1B4_ARATH	PRA1.B4	physical	21798944

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of RABA3_ARATH

Related Literatures of Post-Translational Modification