UniProt ID | RAB8B_RAT | |
---|---|---|
UniProt AC | P70550 | |
Protein Name | Ras-related protein Rab-8B | |
Gene Name | Rab8b | |
Organism | Rattus norvegicus (Rat). | |
Sequence Length | 207 | |
Subcellular Localization |
Cell membrane Lipid-anchor Cytoplasmic side . Cytoplasmic vesicle, phagosome membrane Lipid-anchor Cytoplasmic side. Recruited to phagosomes containing S.aureus or Mycobacterium (By similarity). Colocalizes with CDH1 in the basal compartment.. |
|
Protein Description | The small GTPases Rab are key regulators of intracellular membrane trafficking, from the formation of transport vesicles to their fusion with membranes. Rabs cycle between an inactive GDP-bound form and an active GTP-bound form that is able to recruit to membranes different sets of downstream effectors directly responsible for vesicle formation, movement, tethering and fusion. That Rab may be involved in polarized vesicular trafficking and neurotransmitter release. May participate in cell junction dynamics in Sertoli cells.. | |
Protein Sequence | MAKTYDYLFKLLLIGDSGVGKTCLLFRFSEDAFNTTFISTIGIDFKIRTIELDGKKIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDITNEKSFDNIKNWIRNIEEHASSDVERMILGNKCDMNDKRQVSKERGEKLAIDYGIKFLETSAKSSTNVEEAFFTLARDIMTKLNRKMNDSNSSGAGGPVKITESRSKKTSFFRCSLL | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
3 | Acetylation | -----MAKTYDYLFK -----CCCCHHHHHH | 46.44 | 22636529 | |
4 | Phosphorylation | ----MAKTYDYLFKL ----CCCCHHHHHHH | 16.46 | 30181290 | |
5 | Phosphorylation | ---MAKTYDYLFKLL ---CCCCHHHHHHHH | 11.24 | 30181290 | |
7 | Phosphorylation | -MAKTYDYLFKLLLI -CCCCHHHHHHHHHH | 12.01 | 30181290 | |
58 | Acetylation | ELDGKKIKLQIWDTA EECCEEEEEEEECCC | 43.13 | 14656831 | |
58 | Ubiquitination | ELDGKKIKLQIWDTA EECCEEEEEEEECCC | 43.13 | - | |
72 | Phosphorylation | AGQERFRTITTAYYR CCHHHHHHHHHHHHH | 21.69 | - | |
138 | Acetylation | VSKERGEKLAIDYGI HHHHHHHHHHHHHHH | 46.15 | 22902405 | |
138 | Ubiquitination | VSKERGEKLAIDYGI HHHHHHHHHHHHHHH | 46.15 | - | |
180 | Phosphorylation | LNRKMNDSNSSGAGG HHHHHCCCCCCCCCC | 33.34 | 27097102 | |
182 | Phosphorylation | RKMNDSNSSGAGGPV HHHCCCCCCCCCCCE | 33.82 | 22108457 | |
183 | Phosphorylation | KMNDSNSSGAGGPVK HHCCCCCCCCCCCEE | 36.59 | 27097102 | |
204 | Methylation | KKTSFFRCSLL---- CCCCEEEEECC---- | 2.58 | - | |
204 | Geranylgeranylation | KKTSFFRCSLL---- CCCCEEEEECC---- | 2.58 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RAB8B_RAT !! |
Modified Location | Modified Residue | Modification | Function | Reference |
---|---|---|---|---|
72 | T | Phosphorylation |
| - |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RAB8B_RAT !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of RAB8B_RAT !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...